Method for obtaining series analgesic active peptides DKK and analogs thereof and application of series analgesic active peptide DKK and analogs thereof
A technology of active peptides and analogs, which is applied in the field of biomedicine to achieve the effects of good analgesic activity and simple obtaining method
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0022] Obtaining of Analgesic Active Peptide DKK-1
[0023] 1. Construction of analgesic active peptide DKK-1 expression plasmid
[0024] This example lists and describes the construction strategy and basic method of the recombinant expression plasmid for expressing the analgesic active peptide DKK-1 of the present invention.
[0025] According to the amino acid sequence of the analgesic active peptide DKK-1 (primary structure: DGYIRGSNGCKISCLWGNEGCNKECKGFGAYYGYCWTWGLACWCEGLPDDKTWKSESNTCGGKK), design the corresponding oligonucleotide primer 1 and primer 2, and add restrictions on the 5' ends of the above two oligonucleotide primers respectively Sequences of hydrolysis sites of endonucleases Nde I and BamHI. Using the constructed plasmid containing the DKK-1 gene as a template, PCR amplification was carried out using the above primers 1 and 2, the products were detected by agarose gel electrophoresis, and the nucleic acid fragments were recovered from the gel, passed through t...
Embodiment 2
[0029] Obtaining of Analgesic Active Peptide DKK-2
[0030] The strategy and basic method for obtaining the analgesic active peptide DKK-2 in this example are similar to those in Example 1.
[0031] The structural characteristics of the analgesic active peptide DKK-2 are: DGYIRGSNGCKVSCLWGNDGCNKECRAYGASYGYCWTWGLACWCEGLPDDKTWKSESNTCGGKK.
Embodiment 3
[0033] Obtaining of Analgesic Active Peptide DKK-3
[0034] The strategy and basic method for obtaining the analgesic active peptide DKK-3 in this example are similar to those in Example 1.
[0035] The structural characteristics of the analgesic active peptide DKK-3 are: DGYIRGSNGCKISCLWGNEGCNKECIGFGAYYGYCWTWGLACWCEGLPDDKTWKSESNTCGGKK.
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 

