Method for obtaining series analgesic active peptides DKK and analogs thereof and application of series analgesic active peptide DKK and analogs thereof

A technology of active peptides and analogs, which is applied in the field of biomedicine to achieve the effects of good analgesic activity and simple obtaining method

Active Publication Date: 2010-07-07
SHENYANG PHARMA UNIVERSITY
View PDF1 Cites 4 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

Whether the peptides involved in the above patents and papers have analgesic biological activity has not been reported, therefore, it is necessary to conduct a systematic study on its analgesic biological activity

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Method for obtaining series analgesic active peptides DKK and analogs thereof and application of series analgesic active peptide DKK and analogs thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0022] Obtaining of Analgesic Active Peptide DKK-1

[0023] 1. Construction of analgesic active peptide DKK-1 expression plasmid

[0024] This example lists and describes the construction strategy and basic method of the recombinant expression plasmid for expressing the analgesic active peptide DKK-1 of the present invention.

[0025] According to the amino acid sequence of the analgesic active peptide DKK-1 (primary structure: DGYIRGSNGCKISCLWGNEGCNKECKGFGAYYGYCWTWGLACWCEGLPDDKTWKSESNTCGGKK), design the corresponding oligonucleotide primer 1 and primer 2, and add restrictions on the 5' ends of the above two oligonucleotide primers respectively Sequences of hydrolysis sites of endonucleases Nde I and BamHI. Using the constructed plasmid containing the DKK-1 gene as a template, PCR amplification was carried out using the above primers 1 and 2, the products were detected by agarose gel electrophoresis, and the nucleic acid fragments were recovered from the gel, passed through t...

Embodiment 2

[0029] Obtaining of Analgesic Active Peptide DKK-2

[0030] The strategy and basic method for obtaining the analgesic active peptide DKK-2 in this example are similar to those in Example 1.

[0031] The structural characteristics of the analgesic active peptide DKK-2 are: DGYIRGSNGCKVSCLWGNDGCNKECRAYGASYGYCWTWGLACWCEGLPDDKTWKSESNTCGGKK.

Embodiment 3

[0033] Obtaining of Analgesic Active Peptide DKK-3

[0034] The strategy and basic method for obtaining the analgesic active peptide DKK-3 in this example are similar to those in Example 1.

[0035] The structural characteristics of the analgesic active peptide DKK-3 are: DGYIRGSNGCKISCLWGNEGCNKECIGFGAYYGYCWTWGLACWCEGLPDDKTWKSESNTCGGKK.

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

PUM

No PUM Login to view more

Abstract

The invention belongs to the field of medical biotechnology, and relates to series analgesic active peptides DKK and analogs thereof, a method for obtaining the series analgesic active peptides DKK and the analogs thereof, and application of series analgesic active peptide DKK and the analogs thereof as analgesic medicaments in the field of medicaments. The analgesic active peptides comprise the following amino acid sequences respectively: DGYIRGSNGCKISCLWGNEGCNKECKGFGAYYGYCWTWGLACWCEGLPDDKTWKSESNTCGGKK; DGYIRGSNGCKVSCLWGNDGCNKECRAYGASYGYCWTWGLACWCEGLPDDKTWKSESNTCGGK; DGYIRGSNGCKISCLWGNEGCNKECIGFGAYYGYCWTWGLACWCEGLPDDKTWKSESNTCGGKK; and DGYIRGSNGCKVSCLLGNEGCNKECRAYGASYGYCWTWKLACWCQGLPDDKTWKSESNTCGGKK. The series analgesic active peptides DKK and derivatives thereof or analogs or active fragments can be obtained by using technical expressions of gene engineering and have a simple obtaining method, and an obtained product has good analgesic activity.

Description

technical field [0001] The present invention relates to the technical field of biomedicine, and relates to methods for obtaining a series of analgesic active peptides DKK and their analogs and their application in the field of medicine as analgesic drugs. Specifically, the present invention relates to a series of analgesic active peptides DKK and derivatives thereof. The structure of the drug or analogue or active fragment and its obtaining method and its application in the field of medicine as an analgesic drug. Background technique [0002] Pain is an unpleasant subjective feeling common to all human beings with great individual differences. It provides an alarm signal when the body is threatened, and is an indispensable protection mechanism for life. The patent name is scorpion anti-neuroexcitatory peptide (invention patent number: ZL 00112016.6), which provides a scorpion anti-neuroexcitatory peptide and its gene sequence and function as a drug for the prevention and tre...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

Application Information

Patent Timeline
no application Login to view more
Patent Type & Authority Applications(China)
IPC IPC(8): A61K38/17C07K14/435C07K1/113C12N15/74C12N15/79A61P29/00A61P25/04
Inventor 张景海宋永波吴春福
Owner SHENYANG PHARMA UNIVERSITY
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Try Eureka
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap