A biosafe African swine fever antigen multifactor serum for ELISA diagnosis
A biosafety and African swine fever technology, applied in the direction of serum immunoglobulin, antiviral immunoglobulin, measuring devices, etc., can solve the problem of artificially infected serum that cannot produce African swine fever
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Examples
Embodiment Construction
[0036] The preferred embodiments of the present invention are described in detail below; it should be understood that the preferred embodiments are only for illustrating the present invention, rather than limiting the protection scope of the present invention.
[0037] Four structural proteins, P72, K205R, P54, and A104R expressed by genes, were chemically purified and coated with Freund’s incomplete adjuvant, and the experimental animal pigs were immunized in three batches. After one month, pig blood was collected and serum was separated. , after serological testing, subpackaged and preserved.
[0038] The amino acid sequences of the four expressed structural proteins P72, K205R, P54, and A104R are as follows:
[0039] 1. P72
[0040] 1vsvegtsgpllcnihdlhkphqskpiltdendtqrtcshtnpkflsqhfpenshniqtag
[0041] 61kqditpitdatyldirrnvhyscngpqtpkyyqpplalwiklrfwfnenvnlaipsvsip
[0042] 121fgerfitiklasqkdlvnefpg
[0043] 2. K205R
[0044] 1mvepreqffqdllsavdqqmdtvkndikdimkektsfmvsfen...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More