Unlock instant, AI-driven research and patent intelligence for your innovation.

A biosafe African swine fever antigen multifactor serum for ELISA diagnosis

A biosafety and African swine fever technology, applied in the direction of serum immunoglobulin, antiviral immunoglobulin, measuring devices, etc., can solve the problem of artificially infected serum that cannot produce African swine fever

Inactive Publication Date: 2015-12-02
CHINA ANIMAL HEALTH & EPIDEMIOLOGY CENT
View PDF4 Cites 1 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

Therefore, it is impossible to produce artificial infection serum of African swine fever through experimental technology in China
So far, the African swine fever ELISA diagnostic kits used in China are all purchased from abroad at high prices, and the detection cost of each pig serum sample exceeds 200 yuan, which is far more than that used by farmers or even research institutes. Can withstand economic pressure

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Examples

Experimental program
Comparison scheme
Effect test

Embodiment Construction

[0036] The preferred embodiments of the present invention are described in detail below; it should be understood that the preferred embodiments are only for illustrating the present invention, rather than limiting the protection scope of the present invention.

[0037] Four structural proteins, P72, K205R, P54, and A104R expressed by genes, were chemically purified and coated with Freund’s incomplete adjuvant, and the experimental animal pigs were immunized in three batches. After one month, pig blood was collected and serum was separated. , after serological testing, subpackaged and preserved.

[0038] The amino acid sequences of the four expressed structural proteins P72, K205R, P54, and A104R are as follows:

[0039] 1. P72

[0040] 1vsvegtsgpllcnihdlhkphqskpiltdendtqrtcshtnpkflsqhfpenshniqtag

[0041] 61kqditpitdatyldirrnvhyscngpqtpkyyqpplalwiklrfwfnenvnlaipsvsip

[0042] 121fgerfitiklasqkdlvnefpg

[0043] 2. K205R

[0044] 1mvepreqffqdllsavdqqmdtvkndikdimkektsfmvsfen...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention relates to a biologically safe Africa swine fever antigen multifactorial serum for ELISA (enzyme-linked immuno sorbent assay) diagnosis. A technical scheme adopted in the invention includes: adopting gene-expressed structural protein P72, K205R, P54, and A104R, conducting chemical purification, carrying out coating with a Freund's incomplete adjuvant, performing intramuscular immunization on laboratory swine in three batches, collecting swine blood after one month, separating serum, implementing serological testing, and conducting subpackaging and preservation. The serum is subpackaged into ELISA kits to undergo test according to conventional ELISA test methods.

Description

technical field [0001] The invention relates to a serum, in particular to a biosafety African swine fever antigen multifactor serum for ELISA diagnosis. Background technique [0002] African swine fever is a severe infectious disease of pigs caused by African swine fever virus, which can cause 100% morbidity and mortality in pigs. At present, there is no effective vaccine at home and abroad to prevent this disease. The Bureau listed it as a Class A animal disease. The disease is mainly prevalent in African and European countries and causes huge economic losses. Once the disease occurs, the only measures to be taken are blockade, culling and destruction. In the 1980s, African swine fever occurred in Malta, which eventually led to the slaughter and incineration of all pigs in the country that year. There has never been African swine fever in our country, and we should maintain a high degree of vigilance against African swine fever, because the African swine fever virus spre...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): G01N33/558G01N33/531C07K16/08C07K16/06
Inventor 龚振华王志亮路平王丽萍包静月王淑娟李金明单虎
Owner CHINA ANIMAL HEALTH & EPIDEMIOLOGY CENT