224 results about "Biosafety" patented technology

The invention provides a mineralized collagen cartilage repair scaffold and a preparation method and application thereof, and relates to the technical field of biomedical materials.The preparation method comprises the steps that a collagen solution subjected to mineralization treatment is injected into a mold, and a mineralized collagen layer is obtained through deep freezing and primary freeze drying; taking the mineralized collagen layer as a bottom layer, injecting a collagen solution which is not mineralized, and performing deep freezing and first freeze drying to obtain a freeze-dried scaffold; and carrying out crosslinking and secondary freeze drying on the freeze-dried scaffold, and compressing to obtain the mineralized collagen cartilage repair scaffold. A necessary bioactive interface, a continuous interpenetrating structure of a collagenous fiber network and cross-linking treatment are provided for osseointegration, and interlayer separation is avoided; bidirectional regeneration of osteochondral bone is realized, and complexity and risk of clinical application are reduced; in a wet state, good tailorability and enough stiffness are achieved, and meanwhile stable mechanical support is provided; the technical problem that in the prior art, a stent material is insufficient in systematicness of biosecurity of multi-scale structure bionics and interface bonding agents is solved.

The invention discloses a clinical laboratory specimen full-process tracking and biosafety early warning management system, and relates to the technical field of medical biosafety management, and the system comprises a multi-modal data collection module which integrates various devices and comprehensively collects specimens and related data; the intelligent identification and verification module adopts an advanced algorithm to process the image, completes compliance judgment and traceability verification, and outputs a comprehensive data packet; the dynamic risk assessment module calculates a risk coefficient and matches a five-color early warning level; the grading early warning and linkage disposal module determines an early warning grade, quantifies disposal intensity, and realizes visual management and control and closed loop; according to the method, accurate determination of specimen compliance and full-process traceability verification are realized through deep analysis of an algorithm, data quality and management accuracy are improved, meanwhile, a dynamic risk assessment mechanism is constructed, risks are graded accurately, disposal intensity is quantified, risk visual management and control and closed-loop management are realized, and normalization and controllability of biological safety management are enhanced.

The utility model discloses a high-fidelity quick sampling device of a high-grade biological safety dissecting room, which relates to the technical field of biological sampling devices, and comprises a barrel, a first end of the barrel is provided with a cavity, an inlet communicated with the cavity is arranged at the first end of the barrel, scale marks are arranged outside the barrel, a first cutting part is arranged at the first end of the barrel, and a second cutting part is arranged at the second end of the barrel. The first cutting part has a cutting state and an idle state; the operation part is connected with the cylinder body, the operation part and the inlet are arranged in an avoiding manner, and a barrier layer is arranged between the operation part and the cylinder body; the blocking layer enables substances such as pathogens not to be attached to the operation part, the operation part is detachably connected with the second end of the cylinder body and the blocking layer, and therefore the situation that the pathogens attached to the cylinder body and the blocking layer are attached to the next biological tissue, errors are caused to follow-up identification and analysis of the next biological tissue can be avoided as far as possible. And high fidelity during sampling of different biological tissues is realized.

The invention relates to the technical field of biology, in particular to an MDCK cell strain and application of the MDCK cell strain in preparation of influenza vaccines. The invention provides an MDCK cell strain, the preservation number of which is CCTCC NO: C202504. The cell strain not only can maintain high sensitivity and high yield to influenza viruses and ensure the yield and quality of vaccines, but also can remarkably improve the biological safety of cell matrix influenza vaccines due to elimination of tumorigenicity risk, and has a good application prospect. And a key technical support is provided for promoting domestic research and development and marketing of influenza vaccines based on cell culture.

The invention discloses a DNA molecular marker rapid detection system and method based on imaging spectrum light splitting, and belongs to the technical field of molecular biological detection. The system comprises an exciting light array 1, a receiving and transmitting integrated detection light path 2, an optical fiber transmission array 3, a light splitting module 4, spectral data processing software 5 and a push-broom structure 6. The excitation light array 1 realizes excitation of different labeled samples; the receiving and transmitting integrated detection light path 2 reflects and focuses the array exciting light to a sample and converges fluorescence generated by the sample to an optical fiber input end; the optical fiber transmission array 3 realizes single-row multi-sample fluorescence transmission; the light splitting module 4 is used for dispersing exciting light and fluorescent light of multiple samples in a single row; the spectral analysis processing software 5 is used for acquiring and preprocessing data; the push-sweeping mechanism 6 realizes row-by-row detection of multiple rows of samples. According to the technology, high-throughput, high-sensitivity and rapid detection of the DNA molecular marker is realized. The method is suitable for the fields of fake material evidence identification, food and biological safety and the like, and has the advantages of simplicity and convenience in operation, strong anti-interference performance and the like.

Disclosed herein is a waste encapsulation method comprising: (i) placing an adhesive composition into a compactor; (ii) placing one or more flexible containers containing waste material into the compactor; (iii) heating the binder composition to liquefy the binder composition and embedding the waste into the liquefied binder composition to form a coated mixture; and (iv) compacting the coating mixture and forming a hydrophobic composite article containing the waste material.

This invention discloses an antimicrobial peptide PA targeting multidrug-resistant Gram-negative bacteria and its application. The amino acid sequence of the antimicrobial peptide PA is shown in SEQ ID NO.1. The antimicrobial peptide PA provided by this invention has a significant antibacterial effect against multidrug-resistant Gram-negative bacteria, and has a rapid bactericidal onset, no hemolysis or cytotoxicity, does not cause nephrotoxicity after treatment, and has good biosafety. It can be used for the treatment of bacterial infections and can also be applied to other scenarios that require bactericidal or antibacterial growth inhibition.

This invention provides a negative pressure isolation live microscope experimental box. The experimental box, through its closed negative pressure design, ensures the biosafety of experiments with pathogens of BSL-2 level and above, meeting the requirements of the safety committee review. At the same time, its innovative box-type integrated window structure eliminates the vibration torque caused by animal movement in traditional suspended windows from a mechanical design perspective, providing unparalleled stability for high-precision imaging. Ultimately, it makes it possible to safely and stably conduct live microscopic studies of highly pathogenic infection models in a conventional laboratory.

The present application relates to the technical field of intelligent identification system of crop pests, in particular to a plant field pest fine-grained identification method, system, device and storage medium based on deep learning. The identification method provided by the present application is specialized in high-precision identification of real field scenes, and can provide technical support for important work such as future development of field inspection robot, automatic identification and monitoring system of field pests and the like. In addition to pest monitoring, the field biological safety test of genetically modified plants is gradually carried out at present, and by using the identification method provided by the present application, the dynamic change of farmland insect community can be quickly and accurately identified and predicted, so that the efficiency and accuracy of ecological investigation are greatly improved.

The invention is applicable to the field of genetic engineering, and provides a mycobacterium tuberculosis Mce1A-LS protein nanoparticle, a preparation method and application thereof, the mycobacterium tuberculosis Mce1A-LS protein nanoparticle is formed by sequence fusion of mycobacterium tuberculosis Mce1A protein and LS protein, and the amino acid sequence of the mycobacterium tuberculosis Mce1A-LS protein nanoparticle is shown as SEQ ID NO: 2 in a sequence table. The Mce1A-LS protein nanoparticle provided by the invention is high in immunogenicity, the protein Mce1A with high immunogenicity can induce to generate a synergistic immune effect and is high in safety, and the expressed fusion protein is non-toxic and harmless, so that the biosafety is high, in addition, the immune effect of the Mce1A-LS protein nanoparticle is good, and after the Mce1A-LS protein nanoparticle is used for immunizing a mouse, the immunogenicity of the Mce1A-LS protein nanoparticle is greatly improved. Strong body fluid and / or cellular immune response can be generated, which indicates that after immunization, a specific immune effect can be generated in a mouse body.

The present disclosure belongs to the field of biotechnology, and specifically relates to a seven-component antigen African swine fever subunit vaccine. The present disclosure first provides an African swine fever virus antigen protein combination composed of the African swine fever virus P34 protein, P30 protein, P54 protein, A104R protein, C129R protein, X protein, and Y protein. This African swine fever virus antigen protein combination can induce a strong immune response in the host. Furthermore, the present disclosure provides a seven-component antigen African swine fever subunit vaccine including the aforementioned African swine fever virus antigen protein combination. The seven-component antigen African swine fever subunit vaccine exhibits good immunoprotection rates against challenge with the parental virulent African swine fever virus strain, poses no biosafety risks, overcomes the difficulty that existing African swine fever subunit vaccines domestically and internationally cannot provide effective immunoprotection for pigs.

This invention discloses a lipid nanoparticle co-delivery system based on phenolic hydroxyl lipids and a manganese adjuvant. Addressing the shortcomings of traditional HPV therapeutic peptide vaccines—weak immunogenicity, easy degradation and inactivation in vivo, low bioavailability of manganese ion adjuvants making spatiotemporal co-delivery with antigens, and poor encapsulation efficiency and insufficient biosafety of conventional lipid nanocarriers—this invention constructs an integrated nanovaccine delivery system by embedding phenolic hydroxyl functional lipids into a nanocarrier framework, synergistically loading HPV E6 / E7 specific antigen peptides and manganese ion immune adjuvants. This system achieves efficient delivery, immune activation, and anti-tumor efficacy, integrating the functions of efficient antigen delivery, potent immune activation, and precise anti-tumor action. The preparation process is simple and exhibits excellent stability, overcoming the limitations of traditional HPV peptide vaccines with poor efficacy when used alone. It has broad research value and clinical translation prospects in the field of precision immunotherapy for HPV-related cervical cancer, head and neck squamous cell carcinoma, and other malignant tumors.

The invention discloses a probe for targeting staphylococcus aureus and application of the probe. The amino acid sequence of a nano antibody in the probe is as follows: QVQLVESGGLVQPGGSLRLSCITSGSRFRFGAGW YRQAPGKSRERVAAINFGSF TNYADSVKGRFTISRDDAANTLYLQMNNLRPEDDTAVYYCNTGNYWGEGTQVTVSS, and the amino acid sequence of the nano antibody in the probe is as follows: the amino acid sequence of the nano antibody in the probe is as follows: QVQLVESGGLVQPGGSLSCITSGSRFGAGW YRQAPGKSRERVAAINFGSF The phage display nano antibody has the advantages of high sensitivity, high stability, low cost, easiness in modification, high biological safety and the like. The phage display nano antibody screened by the invention can realize direct detection of staphylococcus aureus, and has high accuracy. The sandwich sensor constructed by the invention can realize the detection limit of 158-2455 CFU / mL, and the detection limit is far lower than that of an existing immunological method.

An RNA room-temperature storage stabilizer, an RNA product, and a preparation method and use thereof are disclosed, belonging to the field of biotechnology. The RNA room-temperature storage stabilizer provided by the present disclosure includes a functionalized polystyrene microsphere. The RNA room-temperature storage stabilizer has good adsorption capacity for RNA. The functional groups on the RNA room-temperature storage stabilizer can interact with the groups in the RNA, which plays a role in stabilizing the structure of the RNA, thereby realizing long-term stable storage of the RNA at room temperature without the need of introducing an ultra-low temperature device and other protective reagents; and the addition of water can destroy the binding between the functionalized polystyrene microsphere and the RNA, so as to achieve complete separation of the RNA from the stabilizer. It has the advantages of low cost, simple operation and high biosafety.

The invention belongs to the technical field of microorganisms, and discloses a phage capable of efficiently splitting escherichia coli and salmonella, a preparation and application of the phage, the name is SP1, the classification name is escherichia coli phage, the preservation number is CGMCC No.46440, the preservation date is China General Microbiological Culture Collection Center on May 30, 2025, and the preservation unit is China General Microbiological Culture Collection Center. The optimal infection complex number of the bacteriophage is 1, the bacteriophage has very strong acid resistance and thermal stability, and the bacteriophage can keep high titer under the conditions that the pH value is 4-11, the temperature is 10-70 DEG C and the ultraviolet irradiation is within 30 minutes. The incubation period of escherichia coli infected by the bacteriophage is about 30 min, the outbreak period is about 40 min after the incubation period, and the bacteriophage can specifically split escherichia coli and salmonella, does not contain virulence and drug-resistant genes and is high in biological safety.

The application belongs to the technical field of biomedical optical imaging, and more particularly relates to a biosafe skin optical clearing agent and method based on a lysine synergistic system. The biosafe skin optical clearing agent provided in the application contains lysine or a salt thereof as an active ingredient, can effectively reduce the light scattering of skin tissue, and thus realizes the optical clearing of skin, and meanwhile, the morphology of the skin tissue is well maintained during the treatment. The skin optical clearing agent has the advantages of simple active ingredient, high biosafety, remarkable skin optical clearing effect, convenient preparation, simple application operation and the like, and is suitable for the optical clearing treatment of ex vivo skin and in vivo skin.

This invention relates to a method for preparing medical nanozymes, the medical nanozymes themselves, their applications, and pharmaceuticals, belonging to the field of biomedicine. It addresses at least one of the following problems in existing technologies for treating deep tissue infections caused by drug-resistant bacteria: poor antibacterial and anti-biofilm effects, insufficient deep tissue penetration, lack of inflammation regulation and tissue repair functions, biosafety risks, and high material preparation costs. The preparation method includes: mixing rhodium trichloride, urea, and polyvinylpyrrolidone to obtain a mixture; subjecting the mixture to staged pyrolysis under inert gas protection to obtain a nitrogen-doped carbon-supported single-atom rhodium catalyst; and modifying the nitrogen-doped carbon-supported single-atom rhodium catalyst with polyethylene glycol. The medical nanozymes prepared by this invention achieve excellent antibacterial and anti-biofilm effects both in vivo and in vitro, can regulate the inflammatory microenvironment, promote tissue repair, exhibit good biocompatibility, and have strong tissue penetration ability.

This invention discloses a method for preparing livestock feed based on the recycling of kitchen waste, relating to the fields of waste resource utilization and feed processing technology. The method includes: transferring raw materials using a closed device; removing inorganic impurities and metals through negative pressure unloading, multi-stage vibration sorting, and magnetic iron removal; adjusting the particle size of the material using a heavy-duty high-speed pulverizer to increase the specific surface area; using high-pressure steam for constant-temperature sterilization to achieve complete harmlessness; inoculating fermentation bacteria after the material has been gradually cooled to a preset range, and carrying out biological fermentation in a controlled environment to produce metabolites; finally, adding corn flour, soybean meal, and wheat bran in proportion for deep mixing. This invention, through the above scheme, achieves complete inactivation of pathogenic bacteria and precise removal of foreign matter, significantly improving the biosafety and digestibility of the recycled feed, realizing a high-value closed-loop recycling of waste, and exhibiting significant environmental and economic benefits.

This invention discloses a chikungunya virus genome fragment armored RNA reference, its preparation method, and its application. The preparation process involves the following steps: (1) constructing the prokaryotic expression backbone vector pACYCAR; (2) cloning the CKV genome fragment CKA (nt17-2276); (3) constructing the prokaryotic expression vector pACYCAR-CKA; (4) inducing the expression of armored RNA; and (5) purifying the armored RNA. This invention solves the technical problems of high biosafety risk, poor stability, and insufficient gene fragment coverage in existing CKV nucleic acid detection references. It fills the gap in the lack of high-quality references for CKV detection.

This invention discloses an enzyme- and pH-responsive nucleic acid loading and delivery material and its preparation method. The material can be used for efficient loading and delivery of nucleic acid molecules. The preparation method uses amphiphilic zwitterionic monomers to improve the reverse emulsion polymerization system, enhancing polymerization at the two-phase interface and avoiding the extrusion effect of polymerization in the aqueous core on nucleic acid molecules, thereby improving the loading efficiency of nucleic acid molecules. Further preparation of cross-linking agents MP-CL and CB-CL, which can cleave in response to matrix metalloproteinase II or cathepsin B, endows the nanogel with the ability to respond to charge reversal in the tumor matrix and to release nucleic acid molecules from tumor cells. The acid-sensitive blocks on the amphiphilic monomers give the nanogel lysosomal escape capability. The delivery material can efficiently deliver nucleic acid molecules into cells and exhibits excellent stability and biosafety.

The present application relates to a kind of two-dimensional metal polyphenol complex nanomaterials that can be enriched in ovary, preparation method and application thereof, the nanomaterial can be enriched in ovary, including two-dimensional metal polyphenol complex as substrate, and follicle-stimulating hormone polypeptide grafted to the surface of the substrate;Wherein, the surface of the two-dimensional metal polyphenol complex grafts-COOH functional group and forms 2D MPC-COOH intermediate, the follicle-stimulating hormone polypeptide is covalently grafted with the-COOH on the surface of 2D MPC-COOH intermediate and obtains the two-dimensional metal polyphenol complex nanomaterial.The technical effect of the present application is that the preparation method of nanomaterial is simple, and nanoparticle dispersibility is good, and biosafety is high, and nanomaterial can physically absorb BRD7 target protein through its special structure, block BRD7 into cell nucleus, and then realize the safe down-regulation of KAT7 path and the effective reversal of granulosa cell stress aging.

This utility model discloses a biosafety double-layer constant temperature and humidity poultry isolation device, comprising: a main body of the device, which has a first isolation chamber and a second isolation chamber arranged vertically inside; an air supply mechanism, which includes an inlet filter and an outlet filter, one end of which is connected to an inlet pipe and an outlet pipe, respectively, and the other end of which is connected to the inner cavity of the first isolation chamber or the second isolation chamber through a vent; and a channel switching mechanism, which is disposed inside the housing of the inlet filter and the outlet filter and at the filter assembly, including a multi-channel structure and a sealing structure. Each branch of the multi-channel structure is independently connected to different filter assemblies, and a detector is set on the air outlet side of the filter assembly. The sealing structure is used to realize the switching of the single-branch connection and on / off state of the multi-channel structure, and is associated with the detector. This utility model can solve the problem that existing isolation devices for poultry laboratory animals are unable to quickly respond to the failure of the air intake disinfection and filtration equipment, resulting in insufficient biosafety.

This invention discloses recombinant humanized type III collagen, its preparation method, and its applications, belonging to the field of medical materials technology. The amino acid sequence of this recombinant humanized type III collagen is any one of SEQ ID No. 2-6. Compared to traditional extraction methods, the amino acid sequence of this recombinant protein is highly consistent with that of natural human proteins, completely avoiding the biosafety risks of pathogens, prions, etc., that may exist during animal-derived extraction, while also exhibiting lower immunogenicity. Furthermore, this protein effectively maintains the natural biological activity and stability of collagen. When used as a wound dressing, this material can efficiently promote cell migration, spreading, and proliferation, accelerate tissue regeneration and wound healing, while possessing excellent biocompatibility, controllable degradation, and low immunogenicity.

The present disclosure relates to a purification method of a monoclonal antibody. The purification method of the present disclosure adopts two-step chromatography to purify a monoclonal antibody against human CCR8, has fewer purification steps, high sample recovery rate, stable process, linear amplification, can obtain a monoclonal antibody with high purity, has less residual host cell protein, DNA, etc. in the purified product, and the purified monoclonal antibody has relatively high biological activity and biosafety.

This invention discloses an octapeptide derived from soybean protein with the function of lowering blood pressure, blood sugar, and cholesterol, as well as its preparation and application, belonging to the field of small molecule peptide technology. The octapeptide sequence is YEGNWGPL, which can be obtained artificially or by targeted enzymatic hydrolysis of soybean protein isolate. Functional verification in a hyperlipidemia model shows that the octapeptide YEGNWGPL has the function of lowering blood lipids; functional verification in a hyperglycemia model shows that the octapeptide YEGNWGPL has the function of lowering blood sugar, with a significantly better effect than the drug metformin; functional verification in a hypertension model shows that the octapeptide YEGNWGPL has the function of lowering blood pressure, with a significantly better effect than the antihypertensive drug captopril; moreover, food-derived bioactive peptides have high biosafety, therefore, they can be applied to the development of related products for lowering blood pressure, blood sugar, and cholesterol or assisting in lowering blood pressure, blood sugar, and cholesterol, with good market prospects and application potential.

The invention discloses an environment-friendly and biosafe neutral efficient sludge dewatering agent and a preparation method thereof, and belongs to the technical field of sludge drying and dewatering. The preparation method of the sludge dewatering agent comprises the following steps: taking cationic polyacrylamide, sodium carboxymethylcellulose and cross-linked modified polyamino deoxyglucose as raw materials, mixing according to a mass ratio of 1: 1: 8, carrying out wet granulation, and then carrying out low-temperature drying and size stabilization on wet particles to prepare a final finished product. The sludge dewatering agent has the beneficial effects that the prepared sludge dewatering agent is neutral, has a triple synergistic flocculation mechanism of charge neutralization, adsorption bridging, network sweeping and space trapping, is excellent in dewatering performance, has extremely high environmental friendliness and biological safety, and is suitable for industrial production. The dehydrated sludge can be used for farmland fertilization, soil improvement, landscaping and composting, and the resource utilization safety and feasibility of the sludge are greatly improved.

The application discloses a biosafety cabinet high-efficiency filter replacement operation method and relates to the technical field of biosafety cabinets.The existing filter purifies air through filtration, so as to ensure the cleanness of the biosafety cabinet.However, the filter needs to be replaced when the purification effect is poor, and the filter needs to be replaced for a period of time, so that the high replacement frequency brings inconvenience to the use of the biosafety cabinet.The application purifies air through the arrangement of different cover plates in sequence, and the dust in the air is removed during the purification.However, bacteria and other microorganisms are accompanied in the dust and other impurities, and the pre-treatment of the bacteria and microorganisms can avoid the delivery into the biosafety cabinet, so that the cleanness of the biosafety cabinet is ensured.The replacement of the biosafety cabinet filter is usually because the ideal filtering effect cannot be achieved, so that the filter needs to be replaced, the filtering effect is improved, the filter life is prolonged, the replacement operation frequency is reduced, and the operation is relatively more convenient.

This invention relates to the fields of environmental monitoring and biosafety technology, and in particular to a viral aerosol sampling patch for face masks, comprising: a capture layer for intercepting viral aerosol particles in the air; a culture layer disposed inside the capture layer, the culture layer comprising a culture unit supporting the virus to maintain activity and replicate in the presence of a host, a host bacterium sensitive to the virus, and a visual indicator indicating viral replication or host response; and a base layer disposed inside the culture layer; the sampling patch is fixed to the face mask through the base layer, and viral aerosol collection is achieved without external power through the capture layer, and countable detection results are generated after sampling through the culture layer; utilizing the airflow and humidity conditions naturally formed during wearing, effective interception, activity preservation, and visual detection of viral aerosols are achieved without complex equipment and additional operating steps, and the operation is simple and repeatable.

This invention discloses a high-level biosafety laboratory intelligent operating robot system and its operation method, comprising: an intelligent mobile chassis capable of mapping and autonomous path planning; a control cabinet mounted on the intelligent mobile chassis; a collaborative robotic arm movably mounted at one end of the control cabinet away from the intelligent mobile chassis; and a telescopic plate movably mounted parallel to the collaborative robotic arm. The end of the collaborative robotic arm is equipped with a manipulation component and an image acquisition component. A reagent bottle fixture is mounted on the telescopic plate, containing a reagent bottle. The telescopic plate is provided with multiple sets of conical holes and multiple ArUco code positioning plates. This invention employs a mobile composite robot system. By mounting a collaborative robotic arm on an intelligent mobile chassis, it completes operational tasks within the biosafety laboratory, offering greater flexibility and wider applicability. Furthermore, the image acquisition component enables high-precision positioning of the collaborative robotic arm, significantly improving its positioning accuracy and enhancing the robot's operational stability.

This invention discloses a disinfection and ventilation system and disinfection method for a biosafety laboratory. The system includes a laboratory room with a first exhaust HEPA filter and an supply HEPA filter installed on the ceiling. The supply HEPA filter is connected to an air outlet via a main supply duct. A fourth biosafety shut-off valve and an air supply unit are sequentially installed along the air supply direction on the main supply duct. The first exhaust HEPA filter is connected to an exhaust outlet via an exhaust duct. A first biosafety shut-off valve, a bag-in / bag-out HEPA filter, an exhaust unit, and a third biosafety shut-off valve are sequentially installed along the exhaust direction on the main exhaust duct. A first bypass duct connects the exhaust duct and the supply duct. The first and third bypass ducts provide a parallel connection for the first exhaust HEPA filter and the bag-in / bag-out HEPA filter, which are connected in series. This invention uses a parallel connection during disinfection, which effectively improves the disinfection effect of the bag-in / bag-out HEPA filter.