Fish serum amyloid P component and use thereof
A serum starch, fish technology, applied in the field of molecular biology, can solve problems such as unknown functions, and achieve the effect of improving anti-bacterial and anti-virus capabilities
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0018] Preparation of recombinant protein of serum amyloid P component
[0019] 1) Construction of plasmid pCsSap expressing serum amyloid P component recombinant protein:
[0020] The amino acid sequence of the serum amyloid P component of the present invention has been published (GenBankaccessionnumberKT025856):
[0021] MMEKLFLFTALMISTCCAVTQDLSGKVFVFPKETNTDHVKLLTTRSTFYNVTVCLRFLTDLNRAYSLFSMSTPTVENAFLIYGEPANHVLHVYSGSGPTFHAVPFPQNTWHSLCSTWGHGSGVAQIWLNGKPYVKKFVTNQPIGGKPISILGQEQDSYGGGFDAAQSFVGMISDVHMWDQVLTPTEIKSYMNHRHVTPGNVFNWRSLQYEITGLVLVDDAPDDM
[0022] The serum amyloid P component consists of 224 amino acids and contains a PTX domain consisting of 21-218 amino acid residues. Serum amyloid P component gene was amplified by PCR with primers SapF1 and SapR1 using the cDNA of tongue sole as template. The PCR conditions were: pre-denatured template DNA at 94°C for 60s, followed by 30 cycles at 94°C for 40s, 58°C for 60s, and 72°C for 60s, and then extended at 72°C for 7-10 minut...
Embodiment 2
[0028] Application of Serum Amyloid P Component - Interaction of Serum Amyloid P Component with Bacteria
[0029]1) Bacterial suspension preparation. The gram-negative bacteria Pseudomonas fluorescens (Pseudomonas fluorescens) were cultured in LB medium (preserved at CGMCC, General Microbiology Center of China Committee for Culture Collection of Microorganisms; the address of the preservation unit is Datun Road, Chaoyang District, Beijing, Chinese Academy of Sciences Institute of Microbiology; the preservation date is January 9, 2008, and the number is CGMCCNo.2329), Edwardsiella tarda (preserved in CGMCC, General Microbiology Center of China Committee for the Collection of Microbial Cultures; the address of the preservation unit is Beijing Datun Road, Chaoyang District, Institute of Microbiology, Chinese Academy of Sciences; preservation date is January 9, 2008, number CGMCCNo.2330), Escherichia coli (DH5α, purchased from "Tiangen Biochemical Technology (Beijing) Co., Ltd." ...
Embodiment 3
[0034] Application of Serum Amyloid P Component-Antibacterial Effect of Serum Amyloid P Component
[0035] The rCsSAP purified in Example 1 above was diluted to 200 ug / ml in PBS, which was the rCsSAP diluent. Pseudomonas fluorescens was cultivated to OD according to the method in Example 2 600 0.8, then centrifuged (5000g, 4°C, 10min), collected the bacteria, suspended in PBS to a final concentration of 10 7 cfu / ml is the bacterial suspension. The bacterial suspension was mixed with equal volume (1:1) of rCsSAP dilution or PBS (control). Twenty tongue soles (about 13.8g in weight) were randomly divided into 2 groups, 10 in each group. These two groups are named A and B respectively. Each fish in group A was injected with 100 ul of bacteria+rCsSAP dilution, and each fish in group B (control group) was injected with 100 ul of bacteria+PBS. At 24 hours after injection, the kidney and spleen tissues of groups A and B were taken, homogenized in 2ml of PBS, and 100ul of the hom...
PUM
| Property | Measurement | Unit |
|---|---|---|
| molecular weight | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information
Login to View More 