Anti-tumor polypeptide HUSP-48 and application thereof
An anti-tumor and anti-tumor drug technology, applied in the direction of anti-tumor drugs, polypeptides and peptides containing localization/targeting motifs, etc., to achieve the effect of inhibiting tumor proliferation and inhibiting tumors
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment Construction
[0020] The principles and features of the present invention will be described below in conjunction with examples. The examples cited are only used to explain the present invention and are not used to limit the scope of the present invention.
[0021] 1. Preparation of peptide HUSP-48
[0022] An anti-tumor polypeptide is synthesized by solid-phase synthesis, which includes a tumor cell killing domain and a membrane penetrating domain, wherein the tumor cell killing domain is located at the C-terminus, and the sequence is shown in SEQ ID NO:1. The domain is located at the N-terminus and the sequence is shown in SEQ ID NO: 2. The amino acid sequence of the obtained peptide is: YGRKKRRQRRR-MVSSARPPTPSDSQHSSHFFFSLKTQKSDSFSREKGTWVPFSPSSFRV (SEQ ID NO: 3), named HUSP-48. For research convenience, we also label FITC with C-terminally labeled fluorescein isothiocyanate on the anti-tumor peptide.
[0023] The small molecule polypeptide HUSP-48 synthesized by the present invention was analyze...
PUM

Abstract
Description
Claims
Application Information

- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com