Check patentability & draft patents in minutes with Patsnap Eureka AI!

Anti-tumor polypeptide HUSP-48 and application thereof

An anti-tumor and anti-tumor drug technology, applied in the direction of anti-tumor drugs, polypeptides and peptides containing localization/targeting motifs, etc., to achieve the effect of inhibiting tumor proliferation and inhibiting tumors

Active Publication Date: 2017-08-22
XIEHE HOSPITAL ATTACHED TO TONGJI MEDICAL COLLEGE HUAZHONG SCI & TECH UNIV
View PDF3 Cites 2 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

According to the different stages of NB, the treatment methods are also different; for the low-risk group, surgical treatment can often be cured; for the intermediate-risk group, surgical resection combined with chemotherapy, the cure rate is between 70-90%; for the high-risk group, Take high-dose chemotherapy, surgical resection and radiotherapy, etc., but the cure rate is only about 30%

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Anti-tumor polypeptide HUSP-48 and application thereof
  • Anti-tumor polypeptide HUSP-48 and application thereof
  • Anti-tumor polypeptide HUSP-48 and application thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment Construction

[0020] The principles and features of the present invention will be described below in conjunction with examples. The examples cited are only used to explain the present invention and are not used to limit the scope of the present invention.

[0021] 1. Preparation of peptide HUSP-48

[0022] An anti-tumor polypeptide is synthesized by solid-phase synthesis, which includes a tumor cell killing domain and a membrane penetrating domain, wherein the tumor cell killing domain is located at the C-terminus, and the sequence is shown in SEQ ID NO:1. The domain is located at the N-terminus and the sequence is shown in SEQ ID NO: 2. The amino acid sequence of the obtained peptide is: YGRKKRRQRRR-MVSSARPPTPSDSQHSSHFFFSLKTQKSDSFSREKGTWVPFSPSSFRV (SEQ ID NO: 3), named HUSP-48. For research convenience, we also label FITC with C-terminally labeled fluorescein isothiocyanate on the anti-tumor peptide.

[0023] The small molecule polypeptide HUSP-48 synthesized by the present invention was analyze...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The present invention provides a polypeptide capable of killing tumor cells and application thereof. The amino acid sequence of the polypeptide is as shown in SEQ ID NO: 1. The invention also relates to an anti-tumor polypeptide and application thereof. The anti-tumor polypeptide comprises a tumor cell killing structural domain and a transmembrane structural domain. The amino acid sequence of the transmembrane structural domain is as shown in SEQ ID NO: 2. The transmembrane structural domain of the anti-tumor polypeptide has no cytotoxicity, but has an obvious effect of inhibiting tumor proliferation and migration invasion after connected to the tumor cell killing structural domain. The anti-tumor polypeptides can be individually used as an anti-tumor biotherapeutic agent and also can inhibit tumors in combination with other treatment methods.

Description

Technical field [0001] The present invention relates to the field of tumor targeted therapy, and more particularly, to a polypeptide capable of killing tumor cells and its application. Background technique [0002] Malignant tumors are important diseases threatening human health. After infectious diseases are controlled, malignant tumors and cardiovascular and cerebrovascular diseases have become the main causes of human death. According to statistics from the World Health Organization, there are more than 10 million new cancer cases worldwide each year, and more than 7 million deaths, including 5.3 million men and 4.7 million women, accounting for 12% of the total deaths, and up to 25% in most developed countries. In my country, malignant tumors have become the main cause of death for urban and rural residents, accounting for more than 20% of deaths. The treatment of malignant tumors requires a lot of manpower and funds, which seriously affects economic construction and social...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): C07K14/00C07K19/00A61K38/16A61K47/42A61P35/00
CPCA61K38/00C07K14/001C07K2319/10
Inventor 童强松郑丽端王晓静方二虎叶霖李聃宋华杰杨枫
Owner XIEHE HOSPITAL ATTACHED TO TONGJI MEDICAL COLLEGE HUAZHONG SCI & TECH UNIV
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More