Patents
Literature
Hiro is an intelligent assistant for R&D personnel, combined with Patent DNA, to facilitate innovative research.
Hiro

241 results about "Surgical resection" patented technology

Colon Resection Colon resection, also known as colectomy is a surgical method of removing a part or the whole of the large intestine. The colon is constituted of ascending, transverse, descending, and sigmoid colon, and the rectum. Resection of the colon is a surgical procedure carried out to remove a part or the whole of an infected colon.

Intussusception and anastomosis apparatus

Apparatus for intratubular intussusception and anastomosis of a hollow organ portion including a cylindrical enclosure, coaxial intratubular intussusception device, for intussusception and clamping means. The apparatus also includes an intratubular anastomosis apparatus for joining organ portions after intussusception thereof with an anastomosis ring and crimping support element. The ring is formed of a shape memory alloy wire, for crimping adjacent organ portions against the crimping support element so as to cause anastomosis therebetween. The ring assumes a plastic or malleable state, at a lower temperature and an elastic state at a higher temperature. The apparatus further includes the crimping support element for intratubular insertion so as to provide a support for crimping the organ portions against the support element. The apparatus additionally includes a surgical excising means, for excising an intussuscepted organ portion, after crimping adjacent intussuscepted organ walls against the crimping support element with the anastomosis ring.
Owner:NITI SURGICAL SOLUTIONS

Kilovoltage delivery system for radiation therapy

A small tabletop stationary five-degree of freedom device such as a “robot” is used to define the treatment region by tracing the region under direct visualization and then to precisely deliver the treatment plan created by an automatic planning system by positioning a single low energy radiation source, or a plurality of low energy sources connected to each other in a predetermined parallel or similar geometry, each source equipped with blocking and attenuation mechanisms, at a plurality of positions in a planar fashion across or through a selected treatment field, thereby delivering a plurality of parallel overlapping beams indexed on a millimeter or submillimeter grid such that a concentration of dose is achieved at a variable depth in tissue relative to the dose where the radiation first enters the tissue and can be used to treat regions on or below the surface of tissue, in a cavity and underlying region created following a surgical resection, on or below the surface of an internal cavity, hollow viscus, or lumen, or deep in tissue adjacent to an inserted probe or conduit or catheter. By generating a plurality of overlapping beams indexed on a millimeter or submillimeter grid that converge on a target volume loaded with gold nanoparticles, a tumorcidal dose of radiation can be delivered in as little as a single session to tumor cells but not to normal cells within or outside the treatment volume. This approach also makes it possible to deliver serial radiosurgical treatments.
Owner:CAROL MARK PHILIP

Prognostic signature for oral squamous cell carcinoma

The present disclosure describes methods and compositions for diagnosing or predicting likelihood of a OSCC recurrence in a subject having undergone OSCC resection comprising: a) determining an expression level of one or more biomarkers selected from Table 4, 5 and / or 7, optionally MMP1, COL4A1, THBS2 and / or P4HA2 in a test sample from the subject, the one or more biomarkers comprising at least one of THBS2 and P4HA2, and b) comparing the expression level of the one or more biomarkers with a control, wherein a difference or a similarity in the expression level of the one or more biomarkers between the test sample and the control is used to diagnose or predict the likelihood of OSCC recurrence in the subject In particular, the present disclosure describes methods and compositions using a four-gene biomarker signature that can predict recurrence of oral squamous cell carcinoma in subjects that have histologically normal surgical resection margins.
Owner:UNIV HEALTH NETWORK

Adam12 as a biomarker for bladder cancer

The present inventors have shown that the gene and protein expression profiles of ADAM8, ADAM10 and ADAM12 in different grades and stages of bladder cancer.ADAM12 gene expression was evaluated in tumors from 96 patients with bladder cancer using a customized Affymetrix GeneChip. Gene expression in bladder cancer was validated using reverse transcription-polymerase chain reaction (RT-PCR), quantitative PCR, and in situ hybridization. Protein expression was evaluated by immunohistochemical staining on tissue arrays of bladder cancers.The presence and relative amount of ADAM12 in the urine of cancer patients were determined by Western blotting and densitometric measurements, respectively.Particularly ADAM12 mRNA expression was significantly upregulated in bladder cancer, as determined by microarray analysis, and the level of ADAM12 mRNA correlated with disease stage. ADAM12 protein expression correlated with tumor stage and grade. ADAM12 was present in higher levels in the urine from bladder cancer patients than in urine from healthy individuals. Significantly, following removal of tumor by surgery, in most bladder cancer cases examined the level of ADAM12 in the urine decreased and, upon recurrence of tumor, increased.
Owner:PHYSICIANS CHOICE LAB SERVICES +1

Temporary tissue spacer and pretreatment balloon

A device for preventing closure of a surgically created resection cavity within tissues of the body comprises an insertion member having a distal end for insertion into a surgically created resection cavity and a proximal end which remains outside the resection cavity and a lumen extending between the proximal and distal ends and an inflatable member deployable from the distal end of the insertion member, an inner chamber of the inflatable member being fluidly coupled to the lumen to receive an inflation fluid therefrom so that, when the inflation fluid is supplied to the inflatable member, the inflatable member expands so that an outer surface of the inflatable member contacts the surrounding tissue and moves the surrounding tissue out of the resection cavity. A method of treating tissue surrounding a surgically created resection cavity, comprises the steps of, after a portion of tissue has been surgically removed to create a resection cavity, inserting a distal end of a catheter into the resection cavity and deploying an inflatable element at a desired location within the resection cavity from a distal portion of the catheter in combination with the steps of inflating the inflatable element to contact inner surfaces of the resection cavity and maintain tissue surrounding the resection cavity in a position substantially corresponding to a position of the tissue prior to the creation of the resection cavity to prevent closure of the resection cavity by healing processes during a recovery period and, after the recovery period, treating the tissue surrounding the resection cavity.
Owner:BOSTON SCI SCIMED INC

Methods of diagnosis and prognosis of pancreatic cancer

The present invention provides novel genes and proteins for diagnosing pancreatic cancer and / or a likelihood for survival e.g., following surgical resection, wherein the expression of the genes and proteins is up-regulated or down-regulated. The pancreatic cancer-associated genes and proteins of the invention are specifically exemplified by the genes and proteins set forth in Tables 3 to 25 and the Sequence Listing.
Owner:GARVAN INST OF MEDICAL RES

Controlled local delivery of chemotherapeutic agents for treating solid tumors

A method and devices for localized delivery of a chemotherapeutic agent to solid tumors, wherein the agent does not cross the blood-brain barrier and is characterized by poor bioavailability and / or short half-lives in vivo, are described. The devices consist of reservoirs which release drug over an extended time period while at the same time preserving the bioactivity and bioavailability of the agent. In the most preferred embodiment, the device consists of biodegradable polymeric matrixes, although reservoirs can also be formulated from non-biodegradable polymers or reservoirs connected to implanted infusion pumps. The devices are implanted within or immediately adjacent the tumors to be treated or the site where they have been surgically removed. The examples demonstrate the efficacy of paclitaxel and camptothecin delivered in polymeric implants prepared by compression molding of biodegradable and non-biodegradable polymers, respectively. The results are highly statistically significant.
Owner:MASSACHUSETTS INST OF TECH +1

Interferon immunotherapy

A method for reducing the recurrence of a resectable malignant tumor includes administering an immunostimulatory dosage of an α-interferon composition, then surgically resecting the malignant tumor. A method for treating a human patient having a non-resectable malignant tumor includes administering an immunostimulatory dosage of an α-interferon composition to the patient and treating the patient with effective non-surgical medical methodologies to diminish the tumor. An article of manufacture combines an α-interferon composition within a packaging material and a package label or insert indicating that administration of an immunostimulatory dosage of an α-interferon composition followed by surgical resection of a malignant tumor can be effective for treating a human patient having the malignant tumor.
Owner:MAYO FOUND FOR MEDICAL EDUCATION & RES

Colon cancer gene expression signatures and methods of use

A gene expression signature of colon cancer, microarrays including them and methods of using the colon gene expression signature are provided. The gene expression signature is especially useful for determining the prognosis of a patient diagnosed with colon cancer, such as stage II colon cancer. The gene signature described herein is also useful for determining effectiveness of surgical resection with or without adjuvant chemotherapy, and determining possibility of cancer recurrence in patients with colon cancer.
Owner:ALMAC DIAGNOSTICS SERVICES LIMITED

Diagnostic markers predictive of outcomes in colorectal cancer treatment and progression and methods of use thereof

Colorectal cancer patients with operable tumors must decide whether to receive adjuvant therapy after surgical resection in order to reduce their chances of recurrence. Current clinical guidelines are crudely based on the stage of the disease, as well as a few other clinicopathologic features. The instant invention integrates data from these clinicopathologic features with data on multiple biomarkers using advanced informatic methods to provide a far more accurate prediction of recurrence than the current guidelines. The instant invention consists of a panel of biomarker assays plus an algorithm into which the scored biomarker data, as well as standard clinicopathologic data, is entered. A tumor sample from an individual patient is submitted for test, and an individualized report is produced with a prognostic score that accurately reflects the patient's risk of recurrence. This helps guide the patient and his / her oncologist in their choice of whether to receive adjuvant treatment. Low-risk patients are spared the unnecessary toxicities associated with cytotoxic treatments, and high-risk patients are given the best chance for a cure, maximizing both life expectancy and quality of life.
Owner:LINKE STEVEN P +2

Surgical resection apparatus

ActiveUS20100286686A1Minimize impactReduce and minimise collateral damageIncision instrumentsSurgical instruments for heatingMicrowaveHigh energy
Surgical cutting apparatus having a treatment channel and a measurement channel for conveying microwave energy from a source to an antenna at a cutting edge. The measurement channel operates at lower power than the treatment channel for determining when higher energy can be safely applied. The apparatus may deliver microwave radiation at differing frequencies to one or more antennas at the cutting edge, e.g. to provide different treatment effects. The source may generate an output for an antenna whose frequency can be selected e.g. for most efficient operation. Selection may be automatic based on detected magnitude and phase of reflected signals during a frequency sweep of a forward signal. Power delivered to tissue via the cutting element may be manually boosted to deal with large blood vessels. The apparatus may include a reflected power monitor for recognising behaviour in reflected signals received from the antenna to trigger automatic pre-emptive action.
Owner:CREO MEDICAL LTD

Methods and Composition for Soft Tissue Feature Reconstruction

InactiveUS20070270948A1Improve growth supporting propertyImprove abilitiesMammary implantsSkin implantsFiberBiopolymer
This present invention describes methods and compositions useful for the reconstruction of various soft tissue features such as lips, areola, and many other features by taking a mold of the skin feature to be replaced, such as the areola, prior to surgical resection, re-creating the size and shape of the soft tissue feature, for example, the nipple and areola, and making a polymer or biopolymer scaffold that is biocompatible, has the ability to allow the epithelization of the skin cells over the polymer, the capability of cell integration into the body of the scaffold, as well as the capability of infiltration of surrounding nerve fibers into the substance of the scaffold, so that the patient may have the benefit of a reconstructed soft tissue feature that not only has the same size and shape and appearance as the native tissue, but also has functional sensation.
Owner:CELLULAR BIOENG

Brachytherapy applicator

ActiveUS20050070753A1Precise deliveryFacilitate accurate and precise deliveryX-ray/gamma-ray/particle-irradiation therapyDiseasePre operative
A breast brachytherapy applicator providing a stable semi permanent / permanent in dwelling platform that is configured to replicate anatomically the excised cancer bed and allows for a more precise anatomically correct delivery of limited field radiation treatment. This device may be used to reconstitute a resected tissue space to its pre-operative size and shape to 1) facilitate the accurate and precise delivery of adjunctive breast brachytherapy following breast cancer surgery and 2) prevent / decrease post-operative deformity as a result of surgical resection, whether for benign or malignant disease, and in particular after radiation treatment of malignant disease in the post lumpectomy patient.
Owner:XOFT INC

Surgical resection device

A surgical organ resection device comprising a plurality of elongate electrodes for insertion into organ tissue, the electrodes being capable of operating in a bipolar manner, and an input for receiving a drive signal for driving the electrode, the elongate electrodes being arranged in a two-dimensional array and / or the device being arranged such that, in use, subsets of the elongate electrodes are driven in turn.
Owner:EMCISION LTD

Application specific emission and transmission tomography

A compact and mobile gantry for 3-dimensional Application Specific Emission and / or Transmission Tomography (ASETT) imaging of the breast in single photon or coincidence emission modes, and single photon, or coincidence, or x-ray transmission modes. While the ASETT gantry was designed, built and evaluated for imaging metabolically active lesions in the pendant breast, it can also be used to image other organs and objects. This system overcomes physical constraints associated with imaging a pendulous breast in prone patients, while simultaneously satisfying sampling criteria for sufficient data collection in the pendulous breast reference frame. When combined with an offset cone-beam tomographic x-ray transmission imaging system, this dual modality ASETT system could provide simultaneous and coregistered structural and functional information about large or dense breasts, breasts with indeterminate x-ray mammography, and could also be used to accurately 3-dimensionally guide biopsy or surgical resection. Moreover, with the offset beam orientation, the transmission system is designed to have a variable FOV and minimize overall absorbed breast dose.
Owner:DUKE UNIV

Recombinant human Claudin18.2 tumor vaccine and preparation method thereof

The invention belongs to the field of medicinal biotechnology, and in particular relates to a recombinant human Claudin18.2 tumor vaccine and a preparation method thereof. The invention aims to solve the problems of immunotherapy for stomach cancer, pancreatic cancer, esophagus cancer and metastatic and non-metastatic ovarian cancer, such as high after-excision recurrence rate, strong chemo-treatment and radiation treatment toxic side effect and high monoclonal antibody therapy cost. The invention adopts a technical proposal that the recombinant human Claudin18.2 tumor vaccine has a sequence of HMKSSQYIKANSKFIGEFDQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPAMLQAV. Animal experiments prove that rhClaudin18.2 fusion protein can induce high-titre neutralizing antibody in the bodies of tumor-bearing mice by over 1:10,000; the antibody can be combined with human KATOIII and PANC-1 tumor cells and mouse stomach cancer MFC and pancreatic cancer MPC-83 cells; and the protein serving as a tumor vaccine can suppress the growth of the stomach cancer MFC and pancreatic cancer MPC-83 cells in the bodies of the mice.
Owner:西安杰诺瓦生物科技有限公司

Endoscopic mucosal resectioning using purified inverse thermosensitive polymers

One aspect of the invention relates to use of a composition comprising a purified inverse thermosensitive polymer in an endoscopic procedure for gastrointestinal mucosal resectioning in a mammal. Another aspect of the invention relates to a method of gastrointestinal mucosal resectioning, comprising administering submucosally to a region of a gastrointestinal mucosa in a mammal an effective amount of a composition comprising a purified inverse thermosensitive polymer; and surgically resecting said region of gastrointestinal mucosa. Yet another aspect of the invention relates to a kit for use in gastrointestinal endoscopic mucosal resectioning in a mammal, comprising a composition comprising a purified inverse thermosensitive polymer; a syringe; and instructions for use thereof.
Owner:GENZYME CORP

Joint Arthroplasty

A system and method for joint arthroplasty may utilize one or more scaffolds to help support an arthroplasty prosthesis for the joint. A natural or prosthetic articulating surface may first be removed from one of the bones of the joint. This may expose a resection surface. A target portion of the resection surface may be identified based on, for example, fit and function testing of the joint with a trial arthroplasty prosthesis in place on the resection surface. One or more scaffolds may be placed on the target portion, and bone cement may be positioned adjacent to the scaffold(s) to define a raised surface that provides better fit and / or function than that which would be obtained with placement on the recessed surface. The arthroplasty prosthesis may be secured to the raised surface through the use of the bone cement.
Owner:PARRY TODD R

Electrophysiological approaches to assess resection and tumor ablation margins and responses to drug therapy

A method and system are provided for determining a condition of a selected region of tissue to facilitate the location of surgical resection margins. Electropotential and impedance are measured at one or more locations in an area of the body where tissue is to be removed. An agent may be introduced into the region of tissue to enhance electrophysiological characteristics of that tissue. The condition of the tissue is measured by electropotential and impedance profile. Differences in the profile are used to determine the borders between normal and abnormal tissue so as to facilitate what tissue to resect. Methods and apparatus are also disclosed to determine the efficacy of various therapies.
Owner:EPI SCI LLC

Bibw 2992 for use in the treatment of triple negative breast cancer

The present invention relates to a method of treating patients suffering from triple negative breast cancer comprising administration of an effective amount of the irreversible EGFR / HER1 and HER2 inhibitor BIBW 2992 (1) to a person in need of such treatment, optionally in combination with the administration of a further chemotherapeutic agent (2), in combination with radiotherapy, radio-immunotherapy and / or tumour resection by surgery.
Owner:BOEHRINGER INGELHEIM INT GMBH

Radionuclide-labelled biodegradable bioabsorbable biopolymer nano fibrous membrane, preparation process and application thereof

The invention relates to a radionuclide-labelled biodegradable bioabsorbable biopolymer nano fibrous membrane, a preparation process and application thereof. The preparation process includes steps of firstly adopting the electrostatic spinning technique to prepare a biopolymer nano fibrous membrane consisting of biopolymer nano fibers with diameters ranging from 50nm to 5000nm, performing chemical modification on the surface of the biopolymer nano fibrous membrane, enabling the surface of the biopolymer nano fibrous membrane to be in coupling reaction with double-functional-group coupling agent, chelating the surface of the biopolymer nano fibrous membrane after coupling reaction in buffer solution of acetic acid-sodium acetate anhydrous containing radionuclide compounds, and finally obtaining the radionuclide-labelled biodegradable bioabsorbable biopolymer nano fibrous membrane, wherein the double-functional-group coupling agent which is combined with amino in biopolymer nano fibers via chemical bonds on the surface of the biopolymer nano fibrous membrane, the radionuclide is chelated and fixed on the surface of the biopolymer nano fibrous surface via the double-functional-group coupling agent. The radionuclide-labelled biodegradable bioabsorbable biopolymer nano fibrous membrane can be used as an oncotherapy material or a material for focal tissue portions after tumor resection operation.
Owner:INST OF CHEM CHINESE ACAD OF SCI +1

Chemoradiotherapy with TS-1/camptothecins

An antitumor agent for chemoradiotherapy of rectal cancer comprising a combination of TS-1 (a combination drug of tegafur, gimeracil, and oteracil potassium at a 1:0.4:1 molar ratio) and CPT-11 (irinotecan hydrochloride). The antitumor agent of the invention can achieve marked tumor volume reduction without causing major side effects, especially by coadministering it with preoperative radiation therapy. The volume of even large tumors that are refractory to surgical resection can be reduced by coadministering the antitumor agent of the invention with preoperative radiation therapy, making the subsequent surgical resection of the tumor easier.
Owner:THE KITASATO INST

Antiviral epicatechins, epicatechin oligomers, or thiolated epicatechins from theobroma cacao for treatment of genital warts

Epicatechins, Epicatechin Oligomers, or Thiolated Epicatechins are applied (A) directly to a genital wart in the form of a cream, ointment, paste or solution, (B) directly to the genital wart wherein such cream, ointment, paste or solution contains as an additional active ingredient a skin permeabilizing agent, (C) following electrosurgical resection or removal of the genital wart in such form of a cream, ointment, paste or solution, (D) following chemical resection or extirpation of the genital wart in such form, (E) following surgical resection or removal of the genital wart in such form, wherein said Epicatechins, Epicatechin Oligomers, or Thiolated Epicatechins both provide antiviral activity against multiple strains of human papilloma virus (HPV) and promote healing following resection polymers contained in a vehicle. Disclosed are the compositions, therapeutical kits containing such composition, methods of treatment using such composition, and methods of enhancing the stability of such composition.
Owner:CACAO BIO TECH

Radioactive therapeutic apparatus

A method and device for applying a radioactive source to a tissue site is disclosed. The device facilitates the precise placement of, for example, 125Iodine seeds relative to the surgical margin, assures the seeds remain fixed in their precise position for the duration of the treatment, overcomes the technical difficulties of manipulating the seeds through the narrow surgical incision, and reduces the radiation dose to the clinicians. The device incorporates the radioactive seeds into a fastening means, preferably surgical staples, used in the surgical procedure. In this way, the seeds are concurrently secured in position directly adjacent to the surgical resection and remain immobile.
Owner:POINT SOURCE TECH

Anticancer sustained-release gel injection containing taxone medicine

A sustained-release gel injection comprises sustained-release microspheres containing taxanes drug, amphiphilic block copolymer, solvent and release regulator, wherein the mixture of the amphiphilic block copolymer and the solvent has a temperature sensitive gelatinization characteristic, and can automatically become non-flowing degradable water insoluble gel, which can locally and slowly release drug at tumor foci for several weeks to several months, after injection into body. The preparation can be injected into or around a tumor for treating solid tumors at different stages. The preparation has the effects of controlling residual tumor cells relapsed after operation and tumors that can not be excised via operation, controlling complications at late stage of tumors, and enhancing treatment effect of chemotherapy and radiotherapy (particularly radioactive particles). The taxanes are selected from docetaxel, taxol, epitaxol, hydroxyl taxol and deacetyltaxol; the amphiphilic block copolymer is PLGA-PEG-PLGA copolymer, wherein the PEG has molecular weight of 1200-1600, accounting for 20 wt% of the amphiphilic block copolymer; and in the glycolide-lactide copolymer, the mol ratio of glycolide and lactide is 6:1.
Owner:济南基福医药科技有限公司

Delivery system for radiation therapy

A small tabletop stationary five-degree of freedom device such as a “robot” is used to define the treatment region by tracing the region under direct visualization and then to precisely deliver the treatment plan created by an automatic planning system by positioning a single low energy radiation source, or a plurality of low energy sources connected to each other in a predetermined parallel or similar geometry, each source equipped with blocking and attenuation mechanisms, at a plurality of positions in a planar fashion across or through a selected treatment field, thereby delivering a plurality of parallel overlapping beams indexed on a millimeter or submillimeter grid such that a concentration of dose is achieved at a variable depth in tissue relative to the dose where the radiation first enters the tissue and can be used to treat regions on or below the surface of tissue, in a cavity and underlying region created following a surgical resection, on or below the surface of an internal cavity, hollow viscus, or lumen, or deep in tissue adjacent to an inserted probe or conduit or catheter. By generating a plurality of overlapping beams indexed on a millimeter or submillimeter grid that converge on a target volume loaded with gold nanoparticles, a tumorcidal dose of radiation can be delivered in as little as a single session to tumor cells but not to normal cells within or outside the treatment volume. This approach also makes it possible to deliver serial radiosurgical treatments.
Owner:TRIPLE RING TECH
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products