Unlock instant, AI-driven research and patent intelligence for your innovation.

A kind of polypeptide bpp capable of protecting and prolonging ovarian function and its application

A technology for ovarian function and premature ovarian failure, applied in the field of reproductive medicine, can solve problems such as toxic side effects and lack of target specificity, and achieve the effects of delaying activation, improving fecundity, and delaying menopause

Active Publication Date: 2020-06-16
NANJING MEDICAL UNIV
View PDF4 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, none of these inhibitors has target specificity, thus causing certain toxic and side effects

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • A kind of polypeptide bpp capable of protecting and prolonging ovarian function and its application
  • A kind of polypeptide bpp capable of protecting and prolonging ovarian function and its application
  • A kind of polypeptide bpp capable of protecting and prolonging ovarian function and its application

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0027] In a study, the applicant found that using Crisper-Cas9 technology to perform a systemic knockout of an ovarian dominant expression gene PROM in mice ( figure 1 : A) It is found that it does not affect various normal physiological functions of the body and the development of fertilized eggs ( figure 1 : B), while the primordial follicle reserve and fecundity of mice increased significantly ( figure 1 : C-E); Mechanism studies found that PROM knockout led to a significant decrease in the activity of mTOR and its downstream transcription factor rps6 in mouse oocytes ( figure 2 : E), the phosphorylation of PROM at Thr423&Ser424 is the key to the activation of PROM translocation from the cell membrane to the cytoplasm ( figure 2 : A-D).

[0028]Therefore, we speculate that the fusion of peptides near the PROM phosphorylation site with the penetrating peptide can exert a dominant-negative effect and inhibit the phosphorylation of endogenous PROM, thereby partially simula...

Embodiment 2

[0032] When adolescent women (20-35 years old) suffer from tumors and need chemotherapy, 1mg / kg BPP can be given by oral administration, infusion and intramuscular injection before, during and after chemotherapy. With 50mg, the dosage is lower than or equivalent to that of general western medicine. Because PROM is predominantly expressed in the ovary, BPP can protect the ovary from premature aging due to excessive activation of chemotherapy drugs without affecting the effect of chemotherapy. Since BPP has no side effects, patients can also take BPP-containing health products and use BPP-containing cosmetics during the period between two chemotherapy cycles. Experimental supporting data see Figure 5 .

Embodiment 3

[0034] For 35-37-year-old women whose primordial follicle reserve in the ovary begins to decrease, they can take BPP-containing tablets orally, or take BPP-containing health products and use BPP-containing cosmetics. Achieve the effect of prolonging ovarian fertility, delaying menopause and female aging. Experimental supporting data see Image 6 .

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention relates to polypeptide BPP capable of protecting and prolonging the ovarian function and application of the polypeptide BPP. The complete sequence of the polypeptide BPP is KETWWETWWTEWSQPKKKRKVQSKRAASIQRTSA. The self-innovated sequence has a cell membrane penetrating function and can specifically inhibit the activity of endogenous PROM, and accordingly the polypeptide BPP can protect and prolong the ovarian function through various administration approaches (intramuscular injection, oral taking, skin absorption by adding the polypeptide BPP into cosmetics and the like), can prevent premature ovarian failure and reproductive ability lowering even loss, caused by the fact that chemotherapeutic drugs excessively activate the follicles, of adolescent female (20-34 years old) during chemotherapy, and has effects of original follicle activation delaying, reproductive ability increasing and menopause delaying on female (35-37 years old) whose ovarian reserve and reproductive ability starts lowering evidently.

Description

technical field [0001] The invention belongs to the field of reproductive medicine, and specifically relates to a polypeptide BPP capable of protecting and prolonging ovarian function and its application. Background technique [0002] As we all know, the female ovary is the key organ for women to maintain their fertility, and the steroid hormones (estrogen, androgen, progesterone) secreted by the ovary are also one of the important factors for women to maintain their health in all aspects. However, the basic functional unit of the ovary, the follicle, begins to continuously activate and die before a woman is born. When approaching menopause (45-50 years old), the remaining follicles are not enough to maintain normal reproductive and hormone secretion functions. From then on, the aging process of women will be faster than that of men. The mTOR signaling pathway is a key pathway that regulates the degree of follicle activation. Currently, researchers around the world mainly u...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): C07K14/00A61K38/16A61P15/00A61P15/08A61K8/64A61Q19/00
CPCA61K8/64A61K38/00A61P15/00A61P15/08A61Q19/00C07K14/00
Inventor 张东杨志霞孙青原朱峰宇王利利朱刚毅
Owner NANJING MEDICAL UNIV