Use of vMIP and congeneric E protein ligand in pharmacy
A protein and drug technology, which is applied to the application field of vMIP and its similar E protein ligands in pharmaceuticals, can solve problems such as impossible to talk about, leukocyte decline, etc., and achieves good prospects and improves the effect of medicinal effects.
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Examples
Embodiment Construction
[0018] The present invention is further described through the following examples.
[0019] Experiments show that the gene expression product of E protein has the effect of binding to the ligand vMIP of the seven transmembrane receptor.
[0020] The results are obtained from the data of the following test process:
[0021] 1. Application of computer software analysis shows that the homology between E protein and human seven transmembrane receptors is: E protein: MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV
[0022] E protein: 19 LFLAFVV-FLL-VT---LAILTAL---RL 39
[0023] LFLAF+V +LL V+ L ILT L RL7 Transmembrane receptor 1: 48 LFLAFLVIYLLTVSGNGLIILTVLVDIRL 76 (gi 21928315, human chromosome 11) 7 Transmembrane receptor 2: 52 LFLAFLVIYLLTVSGNGLIILTVLVDIRL 80 (gi 20558770) 7 Transmembrane receptor 3: 48 LFLAFLVIYLLTVSGNGLIILTVLVDIRL 76 (gi 20884785) E protein: 19 LFLAFVV-FLL-VT--LAILTALRLCAYCCNIVNVSLVKP 54
[0024] LFLAF+V +LL V+ L ILT...
PUM
Abstract
Description
Claims
Application Information
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap