Unlock instant, AI-driven research and patent intelligence for your innovation.

Muc1* antibodies

a monoclonal antibody and muc1 technology, applied in the field of monoclonal antibodies to muc1 *, can solve the problems of reducing the overall yield of the desired antibody, patients rapidly succumbing to sepsis, and cell growth and overall yield reduction, so as to increase antibody production, enhance tumor formation, and stimulate stem-like cell growth.

Inactive Publication Date: 2017-07-20
MINERVA BIOTECH
View PDF0 Cites 4 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Benefits of technology

The patent text describes a method for increasing the growth and survival of stem-like cells, which can produce antibodies, by introducing genes for MUC1* or MUC1* stimulating agents. This can be achieved by injecting a plasmid encoding MUC1* antibody into an antibody-producing hybridoma or adding exogenous anti-MUC1* or its dimerizing ligand NM23 to the cell culture media. The MUC1* stimulating antibody can be administered to patients for the treatment of sepsis or to reduce cell death caused by infections. Overall, the patent text describes a way to enhance antibody production and purity while minimizing contamination.

Problems solved by technology

Reducing the amount of serum in the cell culture media minimizes the carry over contamination but also reduces cell growth and overall yield of the desired antibody.
Patients rapidly succumb to sepsis because of massive cell death.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Muc1* antibodies
  • Muc1* antibodies
  • Muc1* antibodies

Examples

Experimental program
Comparison scheme
Effect test

example 1

n of Anti-MUC1* Monoclonal Antibodies

[0437]Monoclonal antibodies were generated to MUC1* peptide using standard hybridoma generation and subsequent screening, which is familiar to those skilled in the art. A MUC1* peptide (GTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGA, SEQ ID NO:1) or peptide variant bearing a single amino acid substitution (GTINVHDVETQFNQYKTEAASPYNLTISDVSVSDVPFPFSAQSGA, SEQ ID NO:2) was synthesized with an additional cysteine residue at the Carboxy-terminal end to allow conjugation to KLH. The conjugated peptide was used to immunize mice. Supernatants from wells containing fused cells were screened for recognition of the MUC1* peptide by ELISA. Out of these, several clones were selected based on their high titer for their ability to recognize MUC1* peptide in ELISA binding assay. Results of such binding of supernatants from six (6) hybridoma clones are shown in FIG. 1. Clones were then tested by FACS (fluorescence activated cell sorting) for their ability to bind t...

example 2

of Binding of Anti-MUC1* Monoclonal Antibodies to MUC1* on the Cell Surface

[0438]Recognition of MUC1* on the cell surface was analyzed by surface staining of the cells using FACS. For MIN-C2 antibody 50 μl of a 10 μg / ml solution of purified antibody was bound individually to MUC1-negative HCT116 cells transfected with empty vector (HCT116-VEC8), or transfected with MUC1* expressing vector (HCT-MUC1*-10) and MUC1 positive ZR-75-1 cells at 4 degrees Celsius for 30 minutes. Cells were washed twice, and treated with 10 μg / ml anti-mouse-PE at 4 degrees Celsius for 30 minutes. Cells were washed twice, fixed in 2% formaldehyde in PBS, and analyzed using a BD FACS Cantoll flow cytometer (FIG. 2). A similar procedure was followed for MIN-E6 antibody with the only difference that 50 μl of undiluted supernanatnt from MIN-E6 hybridoma was used in place of purified antibody (FIG. 3).

example 3

* Monoclonal Antibodies (Bivalent) MIN-C2 and MIN-E6 Induce Proliferation of MUC1 Expressing Breast Cancer Cell Line

[0439]To measure the ability of anti-MUC1* monoclonal antibodies, MUC1 expressing breast cancer cell line T47D was used. 7,500 cells were plated per well of a 96 well plate in media containing 10% serum. The following day cells in three wells were trypsinized, resuspended in media and counted using a hemocytometer to obtain the zero day count. Media in the cells was changed to that containing 3% FBS and anti-MUC1* antibody was added in various concentrations. 48 hours later media was changed which was followed by a second addition of antibody. After another 48 hours the cells were counted and stimulation of cell growth estimated (FIGS. 4 and 5).

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
molecular massaaaaaaaaaa
timeaaaaaaaaaa
sizeaaaaaaaaaa
Login to View More

Abstract

The present describes monoclonal antibody to MUC1*.

Description

CROSS-REFERENCE TO RELATED APPLICATIONS[0001]The present application claims the benefit of U.S. Provisional Patent Application No. 61 / 103,204, filed Oct. 6, 2008, the contents of which are incorporated by reference in their entirety.BACKGROUND OF THE INVENTION[0002]1. Field of the Invention[0003]The present invention relates to monoclonal antibodies to MUC1* and uses of thereof.[0004]2. General Background and State of the Art[0005]The MUC1 receptor is a Type I transmembrane glycoprotein from the mucin family that has been implicated in many human cancers. It is estimated that approximately 75% of all solid tumors aberrantly express the MUC1 receptor. The group of MUC1+ cancers includes more than 90% of breast carcinomas, 47% of prostate tumors and a high percentage of ovarian, colorectal, lung, and pancreatic cancers. There is some evidence that among the normal functions of the MUC1 receptor are roles in cell adhesion, fertility and immune response. The role of the MUC1 receptor in...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(United States)
IPC IPC(8): C07K16/30C12N5/09
CPCC07K16/3092C12N5/0693C07K2317/35C07K2317/565C07K2317/56C12N2501/998C07K2317/567C07K2317/24C07K2317/55C07K2317/622C07K2317/31C07K2317/21A61K2039/505C07K2317/73A61P35/00A61K39/001117C07K16/30C12N15/11C12N5/16C07K19/00
Inventor BAMDAD, CYNTHIA C.MAHANTA, SANJEEV
Owner MINERVA BIOTECH