O-linked glycosylation using n-acetylglucosaminyl transferases

A technology of glycosylation and transferase, applied in the direction of transferase, chemical instruments and methods, biochemical equipment and methods, etc., can solve problems such as inappropriateness and reduced biological activity of polypeptides

Inactive Publication Date: 2010-07-14
NOVO NORDISK AS
View PDF118 Cites 4 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

Additionally, existing glycosylation sequences may not be suitable for attaching modifying groups to polypeptides
For example, such modifications may result in an undesired decrease in the biological activity of the modified polypeptide

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • O-linked glycosylation using n-acetylglucosaminyl transferases
  • O-linked glycosylation using n-acetylglucosaminyl transferases
  • O-linked glycosylation using n-acetylglucosaminyl transferases

Examples

Experimental program
Comparison scheme
Effect test

preparation example Construction

[0663] Preparation of Modified Sugars

[0664] Typically, a covalent bond is formed between the sugar moiety and the modifying group through the use of a reactive functional group, which is converted into a new organic functional group or a non-reactive species, usually through a linkage process. To form this bond, the modifying group and the sugar moiety carry complementary reactive functional groups. The reactive functional group can be located anywhere on the sugar moiety.

[0665] Reactive groups and reactive classes useful in the practice of the present invention are generally those well known in the art of bioconjugate chemistry. A presently advantageous class of reactions available with reactive sugar moieties are those that proceed under relatively mild conditions. These reactions include, but are not limited to, nucleophilic substitution (e.g., reaction of amines and alcohols with acid halides, active esters), electrophilic substitution (e.g., enamine reaction), and...

Embodiment 1

[0994] Preparation of Mutant Interferon-α-2b-GlcNH-Glycine-PEG-30kDa

[0995] Mutant IFN-α-2b (30 mg, 1.55 micromolar) was buffer exchanged into reaction buffer (50 mM Tris, MgCl) using Centrieon Plus-20 centrifugal filters (5 kDa MWCO) 2 , pH 7.8), to a final protein concentration of 10 mg / mL. Then, UDP-GlcNH-glycine-PEG-30kDa (2 molar equivalents) and MBP-GlcNAc transferase (20mU / mg protein) were added. The reaction mixture was incubated at 32°C until the reaction was complete. The extent of the reaction was determined by SDS-PAGE gel. The product, IFN-a-2b-GlcNH-glycine-PEG-30kDa, was purified as described in the literature (SP-sepharose and Superdex 200 chromatography) before formulation.

[0996] IFNα mutant :

[0997] MCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVPVS 106 RAPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE

[0998] (SEQ ID NO: 234)

[0999] UDP-GlcNH-Glycine-PEG-30kDa :

[1000] ...

Embodiment 2

[1002] Preparation of mutant interferon-α-2b-GlcNH-hexanoylamido-PEG-40kDa

[1003] Mutant IFN-α-2b (1 mg) was buffer exchanged into reaction buffer (50 mM HEPES, MgCl 2 , pH 7.4, 100 mM NaCl), to a final protein concentration of 1 mg / mL. Then, UDP-GlcNH-hexanoylamido-PEG-40 kDa (2 molar equivalents) and MBP-GlcNAc transferase (100 mU / mg protein) were added. The reaction mixture was incubated at 32°C until the reaction was complete. The extent of the reaction was determined by SDS-PAGE gel. The product, IFN-[alpha]-2b-GlcNH-hexanoylamido-PEG-40kDa, was purified as described in the literature (SP-sepharose and Superdex 200 chromatography) before formulation.

[1004] IFNα mutant :

[1005] MCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGPV 106 SRPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE

[1006] (SEQ ID NO: 235)

[1007] UDP-GlcNH-hexanoylamido-PEG-40kDa :

[1008]

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
molecular weightaaaaaaaaaa
Login to View More

Abstract

The present invention provides covalent conjugates between a polypeptide and a modifying group, such as a water-soluble polymer (e.g., PEG). The amino acid sequence of the polypeptide includes one or more O-linked glycosylation sequence, each being a substrate for a GIcNAc transferase. The modifying group is covalently linked to the polypeptide via a glycosyl-linking group interposed between and covalently linked to both the polypeptide and the modifying group. In one embodiment, a glucosamine linking group is directly attached to an amino acid residue of the O-linked glycosylation sequence. The invention further provides methods of making polypeptide conjugates. The present invention also provides non-naturally ocurring polypeptides that include at leats one O-linked linked glycosylation sequence of the invention, wherein each glycosylation sequence is a substrate for a GIcNAc transferase. The invention further provides pharmaceutical compositions that include a polypeptide conjugate of the invention.

Description

[0001] Cross References to Related Applications [0002] This application claims priority under 35 U.S.C. §119(e) to U.S. Provisional Patent Application No. 60 / 941,926, filed June 4, 2007, which is hereby incorporated by reference in its entirety for all Purpose. field of invention [0003] The present invention relates to the field of peptide modification by glycosylation. In particular, the present invention relates to peptide conjugates comprising polymer modifying groups, and methods for preparing glycosylated peptides by using glycosylation sequences that are recognized as substrates by GlcNAc transferase . Background of the invention [0004] Administration of glycosylated and non-glycosylated polypeptides to elicit specific physiological responses is well known in the medical arts. For example, both purified and recombinant hGH are used to treat conditions and diseases associated with hGH deficiency, such as dwarfism in children. Other examples involve interferon,...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityApplications(China)
IPC IPC(8): C12N9/10C12Q1/48
CPCC07K14/51C07K14/535C07K2319/00A61K47/48215C07K14/56C07K14/61A61K47/60
InventorS·德弗利斯
OwnerNOVO NORDISK AS