Edwardsiella tarda recombinant protein vaccines, and preparation and application thereof
A technology of Edwards tarda and recombinant protein, applied in the field of Edwards tarda recombinant protein vaccine and its preparation, can solve the problems of industrial economic loss, Edwardian tarda vaccine, late start and other problems, and achieve high protective effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0023] The two vaccine antigens of Edwardsiella tarda are shown in the amino acid sequences of SEQ ID No. 1 and SEQ ID No. 2 in the sequence table (see sequence table 1 and 2).
[0024] Sequence listing SEQ ID No.1
[0025] MENNLLGDGFKLPKGLTDYGAAAQSWNQYAEKNGLTPEQKQAGLDRLAKGDLPEDTNITKAIVEGYQDGVMIAETWYLGP
[0026] AASVRKVIGGGIIAEIANGSYQWFDLSQPGNGNKSWDWKSSTSAGITGILAPRRSIGQNVGIAMGSAFFTDGPDTGSIGG
[0027] AAAGAWAGGLFGEYASGIVNSLTSKKVPGFIFNTTGSFSSEILGGYIKDAVNGTQLSSERNKEVGE
[0028] (a) Sequence features:
[0029] ●Length: 226
[0030] ●Type: amino acid sequence
[0031] ●Chain type: single chain
[0032] ●Topological structure: linear
[0033] (b) Molecule type: protein
[0034] (c) Assumption: No
[0035] (d) Antisense: No
[0036] (e) Original source: Edwardsiella tarda TX1
[0037] (f) Specific name: E226
[0038] Sequence listing SEQ ID No.2
[0039] ASEKTMDRPGNLIKENQQRAASDEVGRLFRMPITPDGTAVLSGEIGQQPIAIHNVEDANAGELVDSPINDAIAININRASQNNKNN
[0040] AGAGSLTKEQDPMDSLSIRGVG...
Embodiment 2
[0056] The construction method of Edwardsiella tarda vaccine expression vector:
[0057]1) Construction of plasmid pE226: use Edwardsiella tarda TX1 as a template, and use F1 / R1 as primers for PCR amplification. The PCR conditions are: 94°C for 60s to pre-denature the template DNA, then 94°C for 40s, 55°C for 60s, and 72°C 60s, 30 cycles and then extended reaction at 72°C for 10min. After the PCR product was purified with the Tiangen DNA Product Purification Kit, it was ligated with the vector pEASY-E2 (purchased from "Beijing Quanshijin Biotechnology Co., Ltd.") at room temperature for 2-4 hours, and the ligation mixture was transformed into Escherichia coli DH5α containing 100ug / ml Anka penicillin (Ap) was cultured on LB solid medium for 18 hours, a transformant was picked, and the plasmid was extracted, which was plasmid pE266.
[0058] The LB composition is calculated by weight percentage: 1.0% peptone, 0.5% yeast powder, 1.0% sodium chloride, 97.5% distilled water; the b...
Embodiment 3
[0063] Inducible expression and purification of vaccine proteins
[0064] 1) Induced expression and purification of E226 vaccine protein: The plasmid pE226 in the above step 1) was transformed into Escherichia coli BL21 (DE 3) (purchased from "Tiangen Biochemical Technology Co., Ltd.", Beijing) by conventional methods, and the plasmid containing Ap( 100ug / ml) on LB solid medium for 18-24 hours, pick a transformant, and name it BL21 / pE226. Cultivate BL21 / pE226 in LB liquid medium containing Ap (100ug / ml) overnight; take 1ml of overnight culture solution, add 100ml of fresh LB liquid medium containing Ap (100ug / ml), at 37°C Shake at 200rpm to OD 600 0.6, add IPTG with a final concentration of 1mM, continue shaking culture at 37°C at 160rpm for 4-5h, then centrifuge at 5000g, 4°C for 10min, collect the bacterial liquid, add 5ml of lysate, and shake slowly on a shaker at room temperature for 1- 2 hours until the bacterial suspension becomes clear. The bacterial liquid was centr...
PUM
![No PUM](https://static-eureka.patsnap.com/ssr/23.2.0/_nuxt/noPUMSmall.5c5f49c7.png)
Abstract
Description
Claims
Application Information
![application no application](https://static-eureka.patsnap.com/ssr/23.2.0/_nuxt/application.06fe782c.png)
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com