Unlock instant, AI-driven research and patent intelligence for your innovation.

Method for separating functional polypeptide from scale collagen peptide

A fish scale collagen, multi-functional technology, applied in the field of bioengineering, can solve problems such as weak polypeptide characteristics

Inactive Publication Date: 2014-03-12
WEIHAI YUWANG GRP MARINE BIOLOGICAL ENGCO
View PDF0 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

The traditional separation method of different peptides in fish collagen is mainly based on properties such as molecular weight range and charge state, and the characteristics of the obtained peptides are not strong.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0020] Raw material: fish scale collagen peptide powder.

[0021] (1) Make the raw fish scale collagen peptide into an aqueous solution, control the pH at 7.0, and control the concentration at 3mg / ml.

[0022] (2) Load the fish scale collagen peptide aqueous solution to the affinity chromatography column (volume 50L), the ligand of the affinity chromatography medium is the peptide DECEDSETRTFYQIGDSWEKYLQGVRYQCYCYGRGIGEWACEPL; the loading volume is 5L; the particle size of the affinity chromatography medium: 80 -180 microns, the temperature of the chromatographic column is controlled at 10°C.

[0023] (3) Use 80L of ammonium bicarbonate with a concentration of 0.2mol / L as the eluent to elute the chromatography column.

[0024] (4) Use 50L of 20% ethanol aqueous solution to elute the chromatography column at 10°C, and collect all the eluted components.

[0025] (5) Concentrate the eluate to a solid content of 20% by vacuum concentration.

[0026] (6) Spray-dry the collected c...

Embodiment 2

[0028] Raw material: fish scale collagen peptide aqueous solution.

[0029] (1) Adjust the pH of the fish scale collagen peptide aqueous solution to 7.0, and adjust the concentration to 2mg / mL.

[0030] (2) Load the fish scale collagen peptide aqueous solution to the affinity chromatography column (volume 10L). The ligand of the affinity chromatography medium is the peptide DECEDSETRTFYQIGDSWEKYLQGVRYQCYCYGRGIGEWACEPL; the loading volume is 1L; the particle size of the affinity chromatography medium is 80 -180 microns, the temperature of the chromatographic column is controlled at 20°C.

[0031] (3) Use 20L 0.2mol / L sodium acetate-acetic acid buffer (pH7.0) as the eluent to wash the chromatography column.

[0032] (4) Use 10L of 25% ethanol aqueous solution to elute the column at 20°C, and collect all the eluate.

[0033] (5) Concentrate the collected eluate to a solid content of 18% by vacuum concentration.

[0034] (6) Freeze-dry the concentrate directly, and the obtained...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention provides a method for separating a functional polypeptide from a scale collagen peptide. The method comprises the following processes: loading a fish collagen aqueous solution to an affinity column with the polypeptide DECEDSETRTFYQIGDSWEKYLQGCRYQCYCYGRGIGEWACEPL or a polypeptide comprising the sequence as a ligand, leaching the unadsorbed polypeptide with an eluent, leaching the polypeptide bonded with the ligand of the affinity chromatography medium by the eluent, concentrating the eluent, and carrying out freeze drying, thus obtaining white powder, namely the functional polypeptide in the fish collagen. The method has the advantages of simple process and strong characteristics of the polypeptide obtained through separation.

Description

technical field [0001] The invention relates to the technical field of bioengineering, in particular to a method for isolating functional polypeptides using fish scale collagen peptides as raw materials. Background technique [0002] Collagen is a natural biopolymer synthesized by animal cells. As an important component of the extracellular matrix, it exists in almost all tissues, accounting for about 30% of the total animal protein. Collagen has a high ability to resist extension, making skin and other connective tissue Tissues can maintain a certain structure and have special mechanical properties to support and protect cells, tissues and body functions, which is critical to the structure and performance of cells and tissues. Collagen peptide is a polypeptide mixture obtained from collagen as raw material by heat treatment, acid / alkali treatment, enzymatic degradation or a combination of multiple degradation methods. Its main component is a polypeptide with non-uniform mol...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): C07K1/22
Inventor 白义化
Owner WEIHAI YUWANG GRP MARINE BIOLOGICAL ENGCO