Method for separating functional polypeptide from scale collagen peptide
A fish scale collagen, multi-functional technology, applied in the field of bioengineering, can solve problems such as weak polypeptide characteristics
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Examples
Embodiment 1
[0020] Raw material: fish scale collagen peptide powder.
[0021] (1) Make the raw fish scale collagen peptide into an aqueous solution, control the pH at 7.0, and control the concentration at 3mg / ml.
[0022] (2) Load the fish scale collagen peptide aqueous solution to the affinity chromatography column (volume 50L), the ligand of the affinity chromatography medium is the peptide DECEDSETRTFYQIGDSWEKYLQGVRYQCYCYGRGIGEWACEPL; the loading volume is 5L; the particle size of the affinity chromatography medium: 80 -180 microns, the temperature of the chromatographic column is controlled at 10°C.
[0023] (3) Use 80L of ammonium bicarbonate with a concentration of 0.2mol / L as the eluent to elute the chromatography column.
[0024] (4) Use 50L of 20% ethanol aqueous solution to elute the chromatography column at 10°C, and collect all the eluted components.
[0025] (5) Concentrate the eluate to a solid content of 20% by vacuum concentration.
[0026] (6) Spray-dry the collected c...
Embodiment 2
[0028] Raw material: fish scale collagen peptide aqueous solution.
[0029] (1) Adjust the pH of the fish scale collagen peptide aqueous solution to 7.0, and adjust the concentration to 2mg / mL.
[0030] (2) Load the fish scale collagen peptide aqueous solution to the affinity chromatography column (volume 10L). The ligand of the affinity chromatography medium is the peptide DECEDSETRTFYQIGDSWEKYLQGVRYQCYCYGRGIGEWACEPL; the loading volume is 1L; the particle size of the affinity chromatography medium is 80 -180 microns, the temperature of the chromatographic column is controlled at 20°C.
[0031] (3) Use 20L 0.2mol / L sodium acetate-acetic acid buffer (pH7.0) as the eluent to wash the chromatography column.
[0032] (4) Use 10L of 25% ethanol aqueous solution to elute the column at 20°C, and collect all the eluate.
[0033] (5) Concentrate the collected eluate to a solid content of 18% by vacuum concentration.
[0034] (6) Freeze-dry the concentrate directly, and the obtained...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More