Method for quickly measuring fluorescence resonance energy transfer (FRET) efficiency based on simultaneous dual-channel fluorescence intensity detection
A technology of fluorescence resonance energy and transfer efficiency, applied in fluorescence/phosphorescence, measurement devices, and material analysis through optical means, can solve the problems of difficult measurement and achieve the effect of fast FRET micro-quantitative dynamic imaging
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0108] 1. Plasmid source
[0109] The donor fluorescent group is the gene-encoded fluorescent protein Cerulean (abbreviated as C), and the acceptor is the gene-encoded fluorescent protein Venus (abbreviated as V). The protein encoded by the reference tandem plasmid C32V is a peptide chain composed of 32 amino acids (TSGLETRDIRSENLYFQGPREFPGGTAGPVAT). The tandem plasmid CTV is Cerulean-TRAF-Venus, wherein TRAF is a receptor-associated factor domain of a long peptide chain tumor necrosis factor composed of 229 amino acids; the tandem plasmid to be tested CVC (Cerulean-5-Venus-5-Cerulean) contains two donors C and one acceptor V, and C and V are connected by 5 amino acids. These plasmids are purchased from the American addgene plasmid bank (Koushik S V, Blank P S , Vogel S S. Anomalous surplus energy transfer observed with multiple FRET acceptors [J]. PloS one, 2009, 4(11): e8031).
[0110] 2. Dual-channel wide-field fluorescence microscope system
[0111] The dual-channel wide...
PUM

Abstract
Description
Claims
Application Information

- Generate Ideas
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com