Method for preparing high-activity antifreeze proteins AFP134
An antifreeze protein with high activity technology, applied in biochemical equipment and methods, chemical instruments and methods, recombinant DNA technology, etc., can solve problems such as harsh natural conditions and scarce insect content
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment Construction
[0037] 1. Amino Acid Codon Optimization
[0038] The amino acid sequence of Rhagium inquisitor antifreeze protein (GeneBank: HQ540314.1) is as follows:
[0039] MGSS SSGLVPRGSHM CRAVGVDGRAVTDIQGTCHAKATGAGAMASGTSEPGSTSTATA TGRGATARSTSTGRGTATTTATGTASATSNAIGQGTATTTATGSAGGRATGSATTSSSASQPTQTQTITGPGFQTAK SFARNTATTTVTAS
[0040] (The underlined part is the amino acid sequence of antifreeze protein, and the part in bold font is 6×His tag)
[0041] According to the above sequence, the above amino acid sequence is encoded by using Escherichia coli preferred codons to obtain an optimized antifreeze protein coding sequence. And at the 5' of the coding sequence, an NdeI restriction site is added, and a stop codon taa and an XhoI restriction site are added at the 3'. The optimization results are as follows, the part in bold font is the restriction enzyme site, and the lowercase font is the stop codon):
[0042] TGTCGCGCGGTCGGCGTGGATGGTCGTGCGGTTACCGACATCCAGGGCACCTGCCACGCCAAAGCC...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More - R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com



