Method for determining cross-allergy-acting epitopes related to eggs
A technique for determining methods and allergens, applied in chemical instruments and methods, hybridization, specific peptides, etc.
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment Construction
[0048] In order to better explain the present invention and facilitate understanding, the present invention will be described in detail below through specific embodiments in conjunction with the accompanying drawings. The narration of the present invention includes following content:
[0049] (1) Amino acid sequences of egg allergens
[0050] The main allergens of eggs include 6 kinds, namely ovomucoid (the accession number of NCBI is P01005), ovalbumin (the accession number of NCBI is P01012), ovotransferrin (the accession number of NCBI is P02789), lysozyme Enzyme (NCBI accession number is P00698), α-vitelin (NCBI accession number is P19121), yolk glycoprotein 42 (NCBI accession number is P87498). The amino acid sequences of egg allergens retrieved according to the accession numbers of each egg allergen in NCBI are as follows:
[0051] Ovomucoid:
[0052] m 1 AMAGVFVLFSFVLCGFLPDAAFGAEVDCSRFPNATDKEGKDVLVCNKDLRPICGTDGVTYTNDCLLCAYSIEFGTNISKEHDGECKETVPMNCSSYANTTSEDGKVMVLCNRA...
PUM
Property | Measurement | Unit |
---|---|---|
molecular weight | aaaaa | aaaaa |
molecular weight | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap