Unlock instant, AI-driven research and patent intelligence for your innovation.

Method for determining cross-allergy-acting epitopes related to eggs

A technique for determining methods and allergens, applied in chemical instruments and methods, hybridization, specific peptides, etc.

Active Publication Date: 2021-08-13
BEIJING TECHNOLOGY AND BUSINESS UNIVERSITY
View PDF4 Cites 1 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

In addition, other research reports on egg cross-allergens at home and abroad are relatively rare, so it is of great significance to carry out research on egg cross-allergens

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Method for determining cross-allergy-acting epitopes related to eggs
  • Method for determining cross-allergy-acting epitopes related to eggs
  • Method for determining cross-allergy-acting epitopes related to eggs

Examples

Experimental program
Comparison scheme
Effect test

Embodiment Construction

[0048] In order to better explain the present invention and facilitate understanding, the present invention will be described in detail below through specific embodiments in conjunction with the accompanying drawings. The narration of the present invention includes following content:

[0049] (1) Amino acid sequences of egg allergens

[0050] The main allergens of eggs include 6 kinds, namely ovomucoid (the accession number of NCBI is P01005), ovalbumin (the accession number of NCBI is P01012), ovotransferrin (the accession number of NCBI is P02789), lysozyme Enzyme (NCBI accession number is P00698), α-vitelin (NCBI accession number is P19121), yolk glycoprotein 42 (NCBI accession number is P87498). The amino acid sequences of egg allergens retrieved according to the accession numbers of each egg allergen in NCBI are as follows:

[0051] Ovomucoid:

[0052] m 1 AMAGVFVLFSFVLCGFLPDAAFGAEVDCSRFPNATDKEGKDVLVCNKDLRPICGTDGVTYTNDCLLCAYSIEFGTNISKEHDGECKETVPMNCSSYANTTSEDGKVMVLCNRA...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
molecular weightaaaaaaaaaa
molecular weightaaaaaaaaaa
Login to View More

Abstract

The invention relates to a method for determining cross-allergy-acting epitopes related to eggs. The method comprises the following steps: S1, retrieving amino acid sequences of main allergens of eggs through NCBI; S2, manually inputting an amino acid sequence of a main allergen of a certain food, comparing the similarity of the input allergen sequence and an allergen sequence of eggs through a tool Align in a page Uniprot, and predicting whether cross-allergy is present or not; S3, in the presence of cross-allergy, predicting a secondary structure and antigenic epitopes of the egg allergen presenting cross-allergy through a tool Protean in software DNAstar; S4, based on the prediction in S3, analyzing similar sequences of the egg allergens with cross-allergy and allergen proteins by using a tool web page Blastp; S5, preparing a corresponding monoclonal or polyclonal antibodies with the proteins presenting cross-allergic reaction in the step S2, identifying cross-allergens by using an immunoblotting method and the ELISA method, further synthesizing the similar sequence determined in the step S4, and identifying whether the similar sequence is a reaction epitope or not by using serology.

Description

technical field [0001] The invention relates to the technical field of food safety, in particular to a method for determining an egg-related cross-allergen action epitope. Background technique [0002] Research on allergic food has become one of the concerns of food safety. Food allergy is an immune response mediated by IgE or IgG after certain foreign proteins enter the body. Food allergy is an important public health problem and is on the rise. People who are allergic to certain foods may also have allergic reactions when eating other foods, which is called food cross allergy. Several studies have shown that cross-reactivity to completely different allergens can occur within the same organism. This may be due to the fact that the 2 allergens have similar linear epitopes, so that cross-allergic reactions occur, for example, patients allergic to spores may cross-react with alternative foods. Cross-allergic reactions among the food allergens of apple and celery have been ...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): G16B30/10G16B25/10G01N33/68G01N33/573C07K14/76C07K14/47
CPCG16B30/10G16B25/10G01N33/6893G01N33/6854G01N33/573C07K14/76C07K14/47G01N2333/77G01N2333/79G01N2333/4713G01N2333/4731G01N2333/936G01N2333/47G01N2333/76
Inventor 丛艳君王广玉
Owner BEIJING TECHNOLOGY AND BUSINESS UNIVERSITY
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More