Combination detection reagent for detecting schistosomiasis and detecting method thereof
A technology for combined detection and schistosomiasis, applied in biological testing, chemical instruments and methods, measuring devices, etc., can solve the problems of people's health and social and economic development losses in epidemic areas, serious epidemics of this disease, etc., and achieve low cost and sensitive detection Strong, easy to standardize the effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Examples
Embodiment
[0038] The combined detection reagent for the detection of schistosomiasis is characterized in that it is composed of the following raw materials with the following concentration ratios:
[0039] Recombinant antigen mixture 0.2-0.4ug / well
[0040] Recombinant schistosome signal protein 14-3-3 monoclonal antibody (14-3-3mAb) 0.5-1ug / well,
[0041] The recombinant antigen mixture is:
[0042] A. Recombinant schistosome signal protein 14-3-3 (rSj14-3-3) 0.1-0.2ug / well
[0043] B. Recombinant Schistosoma glutathione-S-transferase (GST) 0.1-0.2ug / well
[0044] And A and B are mixed according to the protein concentration of 1:1;
[0045] Recombinant schistosome signal protein 14-3-3 (rSj14-3-3): protein, PI: 4.86; molecular weight: 29KD; containing 254 amino acids:
[0046] MRDSFVLQQKDLSPSDLVQIARLAEQAERYDDMAAAMKAYAELPAELGSEERNLFSVAYKNVVGARRSAWRVISAVEHKHDENSKKRQLTKEYRVKMEEELNEICREVLTLLSKYLTPKSNGFESQVFYRKMEGDYYRYLAEVATGDARKEVVEKSQAAYEKATEIAEEMLPSTHPIRLGLALNFSVFYYEIKCDPTQACNLAKRAFD...
PUM
Property | Measurement | Unit |
---|---|---|
Molecular weight | aaaaa | aaaaa |
Molecular weight | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap