Supplemented matrices for the repair of bone fractures
A matrix and mineral technology, applied in medical science, prosthesis, etc., can solve problems such as healing fractures that are not described
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0118] Example 1: PTH 1-34 And TGpl PTH 1-34 Biological activity
[0119] Full-length PTH 1-84 PTH with similar activity 1-34 Peptides and proteins of this length can be synthesized by standard solid-state peptide synthesis methods.
[0120] All peptides were synthesized on solid resin using an automated peptide synthesizer using standard 9-fluorenylmethoxycarbonyl chemistry. The peptides were purified by cl 8 chromatography and analyzed by HPLC with reverse phase chromatography to determine purity and mass spectrometry (MALDI) analysis to identify the molecular weight of each product. Using this method, PTH was synthesized 1-34 And TG-pl-PTH 1-34 NQEQVPLYKNRSVSEIQLMHNLGKHLNSMERVEWL-RKKLQDVHNF (SEQ ID NO.19) and TG PTH 1-34 NQEQVPLSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF (SEQ ID NO. 20). TGplPTH 1-34 And TG PTH 1-34 With PTH 1-34 The difference is that it additionally contains a factor XIIIa substrate domain, which is linked to PTH through the plasmin-degradable pl sequence YKNR (SEQ ID...
Embodiment 2
[0122] Example 2: Release of PTH from the fibrin matrix
[0123] Fibrin Matrix by TISSEEL Kit (Baxter AG, CH-8604Volketswil / ZH) fibrin precursor component preparation. The composition is listed in Table 2. At 0,1μg / ml PTH 1-34 Or TGPTH 1-34 In the presence of thrombin, add thrombin and mix to form a uniform concentration. TGPTH 1-34 It only has a transglutaminase sequence at the amino terminus and no degradation sites. Therefore, TGPTH 1-34 It can only be released by the degradation of the fibrin matrix itself. The peptide was synthesized as described in Example 1.
[0124] For the first release assay, 50 μl fibrin matrix with 0.1 mg PTH or TGPTH / ml fibrin matrix was incubated in 10 ml buffer at 37°C. Therefore, for total release, the concentration of PTH or TGPTH in the buffer will be 0.5 μg PTH or TGPTH / ml fibrin matrix. In order to compare the stability of PTH or TGPTH during the measurement, the PTH or TGPTH sample was directly diluted in buffer to a concentration of 0.5 μg ...
Embodiment 3
[0128] Example 3: Sheep tibia defect model
[0129] From TISSEEL Kit (Baxter AG, CH-8604 Volketswil / ZH) began to form a fibrin matrix, resulting in 4ml fibrin matrix. TISSEEL It is produced from combined human-sourced plasma and the content of the active ingredient can vary from batch to batch within a predetermined range.
[0130] Matrix: Three separate syringes were used to prepare the matrix, a two-way syringe containing fibrin precursor solution and PTH fusion peptide (syringes 1 and 2), and two one-way syringes containing particles (syringes 3 and 4). Table 2 lists the final composition used.
[0131] Table 2: Including TISSEEL And the final composition of the active ingredient
[0132] Ingredients
Dosage / 2ml gel
Syringe 1 (1mL)
PTH 1-34 Fusion peptide (TGplPTH 1-34 )
0.4-10mg
Coagulant
Fibrinogen (human)
Other proteins
Aprotinin (bovine)
Buffer component
L-histidi...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 