Avian influenza virus head protein as well as preparation method and application thereof
A bird flu virus and protein technology, applied in biochemical equipment and methods, virus peptides, antiviral agents, etc., can solve the problems of long production cycle and high production cost, reduce production cost, shorten production time, and ensure biological safety Effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0028] Example 1 Influenza virus protein
[0029] The amino acid composition of the influenza protein is shown in SEQ ID NO.1.
[0030] SEQ ID NO.1:PLILRDCSVAGWLLGNPMCDEFLNVPEWSYIVEKINPANDLCYPGNFNDYEELKHLLSRINHFEKIQIIPKSSWSDHEASSGVSSACPYQGRSSFFRNVVWLIKKNNAYPTIKRSYNNTNQEDLLVLWGIHHPNDAAEQTRLYQNPTTYISVGTSTLNQRLVPKIATRSKVNGQSGRMEFFWTILKPNDAINFESNGNFIAPENAYKIVKKGD
[0031] The amino acid composition of the influenza virus protein can also be: a protein whose amino acid sequence in the protein shown in SEQ ID NO.1 is substituted, deleted or added with one or several amino acids and has influenza protein antigenicity, such as SEQ ID NO.2 :
[0032] PLILRDCSVAGWLLGNPMCDEFINVPEWSYIVEKASPANDLCYPGNFNDYEELKHLLSRINHFEKIQIIPKSSWSNHDASSGVSSACPYLGRSSFFRNVVWLIKKNSAYPTIKRSYNNTNQEDLLVLWGIHHPNDAAEQTKLYQNPTTYISVGTSTLNQRLVPEIATRPKVNGQSGRMEFFWTILKPNDAINFESNGNFIAPEYAYKIVKKGD;或SEQ ID NO.3:
[0033] PLILRDCSVAGWLLGNPMCDEFINVPEWSYIVEKANPANDLCYPGNFNDYEELKHLLSRINHFEKIQIIPKSSWSDHEASSGVSSACPYQGVPSFFRNVV...
Embodiment 2
[0034] Example 2 Preparation of influenza virus protein
[0035] 1. Obtaining the target gene
[0036] The influenza virus A / Bar-headed Goose / Qinghai / 60 / 05(H5N1) GenBank: DQ095615.1 selected in this experiment. According to the sequence of GenBank: DQ095615.1, the nucleotide sequence of SEQ ID NO.4 was artificially synthesized (this synthesis was provided by Shanghai Sangon Bioengineering Technology Service Co., Ltd.),
[0037] atgcctctaat tttaagagat tgtagtgtag ctggatggct cctcgggaac ccaatgtgtg acgaattcct caatgtgccg gaatggtctt acatagtgga gaagatcaat ccagccaatg acctctgtta cccagggaat ttcaacgact atgaagaact gaaacaccta ttgagcagaa taaaccattt tgagaaaatt cagatcatcc ccaaaagttc ttggtcagat catgaagcct catcaggggt gagctcagca tgtccatacc agggaaggtc ctcctttttt agaaatgtgg tatggcttat caaaaagaac aatgcatacc caacaataaa gagaagttac aataatacca accaagaaga tcttttggta ctgtggggga ttcaccatcc aaatgatgcg gcagagcaga caaggctcta tcaaaaccca accacctata tttccgttgg gacatcaaca ctaaaccaga gattggtacc aaaaatagct a...
Embodiment 3
[0062] Example 3 Protein Animal Test
[0063] H5HA head region protein immunogenicity experiment:
[0064] Experimental animals: 24 SPF chickens, each group of 6 divided into 4 groups, namely: blank control group, adjuvant control group, 50 μg antigen amount group, 100 μg antigen amount group
[0065] Reagents: complete Freund's adjuvant and incomplete Freund's adjuvant were purchased from Sigma
[0066] Methods: 50 μg and 100 μg of purified H5HA head region recombinant protein were mixed with Freund's complete adjuvant for intramuscular injection immunization, and 3 weeks later, the corresponding antigen was mixed with incomplete Freund's adjuvant for booster immunization. At the same time, a blank control group and an adjuvant control group were set up. Chicken serum was collected before immunization and 10 days after the last immunization. On the 21st day after the last immunization, 50 μL containing 10 6 EID 50 A Bar-headed Goose Qinghai / 1 / 2005 (H5N1) v...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 