vnsak polypeptide and its application
A technology of HLA-A and HLA-A24, which is applied in the field of VNSAK polypeptides, can solve the problems of weak immunogenicity and immune tolerance, and achieve the effects of enhanced immunogenicity, stable binding, and accelerated activation
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0031] Example 1. Preparation of DC cells loaded with VNSAK polypeptides and VNSAK polypeptide-specific effector cells
[0032] 1. Preparation of DC cells loaded with VNSAK polypeptide
[0033] Principle: PBMC induces DC cells, and DC cells can phagocytize VNSAK polypeptides to form DC cells loaded with VNSAK polypeptides.
[0034] Cell culture in this step was carried out at 37°C, 5% CO 2 performed in the incubator.
[0035] 1. Synthesize the polypeptide shown in Sequence 1 of the sequence listing (named VNSAK polypeptide).
[0036] Sequence 1 of the Sequence Listing: VYDYNCHVDLNVLHFFNAPLSLLMWITQCAAYKDEL.
[0037] 2. Take human peripheral blood and separate peripheral blood mononuclear cells (PBMC).
[0038] 3. Take the peripheral blood mononuclear cells obtained in step 2, and use RPMI-1640 culture medium to prepare 5×10 6 cells / ml of cell suspension.
[0039] 4. Add the cell suspension obtained in step 3 into the cell culture flask and incubate for 2 hours (to allow D...
Embodiment 2
[0060] Example 2, the ability of effector cells to produce IFN-γ
[0061] ELISPOT Detection Kit (Human IFN-γ ELISPOT Kit): Shenzhen Juying Biotechnology Co., Ltd., catalog number "856 051 001", IFN-γ capture antibody, biotin-labeled anti-IFN-γ antibody and streptavidin labeling The alkaline phosphatase is a component of the kit. The effector cell suspension refers to the VNSAK-CTL system, VAK-CTL system, NAK-CTL system or SAK-CTL system prepared in Example 1.
[0062] Take the effector cell suspension, use the ELISPOT detection kit and operate according to the instructions of the kit, and detect the ability of various effector cells to produce IFN-γ. The specific steps are as follows: add 70% (volume ratio) ethanol aqueous solution to the 96-well plate, room After incubation for 10 minutes, wash with PBS buffer, then add 100 μl of IFN-γ capture antibody diluted to 100 times volume with PBS buffer to each well, incubate at 4°C for 12 hours, then wash with PBS buffer; then add ...
Embodiment 3
[0064] Example 3, Killing effect of effector cells on target cells
[0065] T2 cells: ATCC, ATCC number is " CRL-1992 TM ".
[0066] 1. Preparation of T2 cells loaded with antigenic peptides
[0067] 1. Preparation of T2 cells loaded with VAK polypeptide
[0068] In RPMI-1640 culture medium, artificially synthesized VAK polypeptide was mixed with T2 cells at 37°C, 5% CO 2 Incubate under the same conditions for 24 hours (at the initial moment of incubation, the concentration of VAK polypeptide is 50 μg / ml, the concentration of T2 cells is 1×1 0 6 cells / ml), and then collect the cells, which are T2 cells loaded with VAK polypeptide.
[0069] 2. Preparation of T2 cells loaded with NAK polypeptide
[0070] In RPMI-1640 culture medium, artificially synthesized NAK polypeptide was mixed with T2 cells at 37°C, 5% CO 2 Incubate for 24 hours under the same conditions (at the initial moment of incubation, the concentration of NAK polypeptide is 50 μg / ml, the concentration of T2 ...
PUM

Abstract
Description
Claims
Application Information

- R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com