Method for preparing ularitide
A technology of ularitide and linear peptide, which is applied in the field of preparation of ularitide, can solve the problems of high cost and inability to increase the yield of ularitide, and achieve the effects of low cost, favorable promotion, and simple method and process
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Examples
Embodiment 1
[0036] A method for preparing ularitide, the amino acid sequence of said ularitide is shown in SEQ ID No.1: TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY;
[0037] The preparation method comprises the following steps:
[0038] 1) Synthesis of fully protected linear peptide resin:
[0039] Using Fmoc-Tyr(tbu)-Wang Resin resin as a solid phase carrier, the Fmoc-Tyr(tbu)-WangResin resin was mixed with DCM, agitated for 30min to fully swell the resin, then the solution was drawn off, and the Fmoc-Tyr(tbu)-WangResin resin was mixed with DCM. Tyr(tbu)-Wang Resin resin was washed three times.
[0040]To Fmoc-Tyr (tbu)-Wang Resin resin, add its volume concentration of 2.5 times volume to the DBLK solution of 20% to react for 5min, then suction filter, wash with DMF, suction filter, add the volume of resin 2.5 times volume again React with 20% DBLK solution for 10 minutes to obtain H-Tyr(tbu)-Wang Resin; wash six times with DMF and remove the solution; take Fmoc-Arg(pdf)-OH and H-Tyr-(tbu)-Wang R...
Embodiment 2
[0052] A method for preparing ularitide, the amino acid sequence of said ularitide is shown in SEQ ID No.1: TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY;
[0053] The preparation method comprises the following steps:
[0054] 1) Synthesis of fully protected linear peptide resin:
[0055] Using Wang Resin resin as a solid phase carrier, Fmoc-Tyr(tbu)-OH was coupled on Wang Resin resin to obtain Fmoc-Tyr(tbu)-Wang Resin resin. With Fmoc-Tyr (tbu)-Wang Resin resin as a solid phase carrier, the Fmoc-Tyr (tbu)-Wang Resin resin was mixed and shaken with DMF for 25min to fully swell the resin, then the solution was drawn off, and the Fmoc- Tyr(tbu)-Wang Resin resin was washed three times.
[0056] To the Fmoc-Tyr(tbu)-Wang Resin resin, add its volume concentration of 2 times the volume of the 20% DBLK solution to react for 6min, then filter with suction, wash with DMF, filter with suction, and then add the quality of 2 times the volume of the resin React with 20% DBLK solution for 12 minutes ...
Embodiment 3
[0068] A method for preparing ularitide, the amino acid sequence of said ularitide is shown in SEQ ID No.1: TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY;
[0069] The preparation method comprises the following steps:
[0070] 1) Synthesis of fully protected linear peptide resin:
[0071] Using Fmoc-Tyr(tbu)-Wang Resin resin as a solid phase carrier, the Fmoc-Tyr(tbu)-WangResin resin was mixed with DCM, stirred for 35min to fully swell the resin, then the solution was drawn off, and the Fmoc-Tyr(tbu)-WangResin was mixed with DMF Tyr(tbu)-Wang Resin resin was washed three times.
[0072] To Fmoc-Tyr(tbu)-Wang Resin resin, add 3 times its volume concentration to the DBLK solution of 20% to react for 4min, then filter with suction, wash with DMF, filter with suction, then add 3 times of volume of resin React with 20% DBLK solution for 8 minutes to obtain H-Tyr(tbu)-Wang Resin; wash three times with DMF and remove the solution; take Fmoc-Arg(pdf)-OH and H-Tyr-(tbu)-Wang Resin Coupling is ca...
PUM

Abstract
Description
Claims
Application Information

- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com