83 results about "Natriuretic peptide" patented technology

The invention provides a clinical diagnosis and treatment path generation method and system for tracking a chest pain patient. Wherein a dynamic spatio-temporal data atlas is constructed by synchronously collecting respiratory rhythm phase difference, coronary artery calcification integral and hypersensitive troponin curve slope, and risk degree transition signals are generated by coupling analysis of ST segment elevation amplitude asymmetric growth, left ventricular ejection fraction attenuation gradient and B-type natriuretic peptide release rate. In the acute stage, the constraint relation between a vascular recanalization time window and thrombolysis taboo is dynamically bound, in the subacute stage, a phase synchronization rule for enhancing CT scanning and anticoagulant drug dosage is established through a multidisciplinary interface, intravascular ultrasonic plaque morphological mutation characteristics and extracorporeal circulation parameters are fused, the blood supply reconstruction time sequence is dynamically adjusted based on a myocardial oxygen consumption balance equation, and the thrombolysis time sequence is determined. And path self-optimization is realized through space-time superposition of an interventional therapy delay parameter and a drug metabolism curve. According to the technical scheme provided by the invention, chest pain diagnosis and treatment path dynamic optimization and multi-modal parameter collaborative decision-making are realized, and the risk layering precision and the treatment timeliness are improved.

A wearable heart monitoring device includes a carrier and a housing. The carrier includes a first electrode defining a sensor configured to measure at least one of b-type natriuretic peptide (BNP), N-terminal pro b-type natriuretic peptide (NT-proBNP), or Troponin. Moreover, a second electrode is configured to measure at least one of parameter associated with a heart, heart disease, or heart disease treatment, of a patient wearing the heart monitoring device. The housing includes an adhesive thereon. The housing is coupled to the carrier. Moreover, the housing contains a controller communicably coupled to the first electrode and the second electrode, memory coupled to the controller, and a communication interface communicably coupled to the controller.

The present disclosure relates to a polypeptide construct for targeted delivery of a payload, comprising a natriuretic peptide receptor (NPR-C) ligand. Also provided is a conjugate comprising; a polypeptide construct for targeted delivery of a payload to NPR-C expressing cells. Further provided are compositions comprising the construct or the conjugate, and kits comprising the construct and a crosslinker, and methods and uses of the same.

treatment of skeletal dysplasias in children, and improvement in one or more symptoms of skeletal dysplasias, such as long bone growth or growth velocity, by administering variants of C-type natriuretic peptide (CNP) is described.

The invention belongs to the technical field of food nutrition, and discloses application of an artemisia selengensis extract in preparation of a medicine for improving neurodevelopmental disorder and the medicine. The artemisia selengensis extract has the following advantages and effects: the research finds that the artemisia selengensis extract has the effect of improving neurodevelopmental disorders, which is specifically embodied in that the artemisia selengensis extract can effectively increase the activity of acetylcholin esterase, lower the content of ROS (reactive oxygen species), up-regulate antioxidant indexes (GSH (glutathione) content and sod1 and cat gene expression) and relieve oxidative stress injury of zebrafish caused by NP (natriuretic peptide); meanwhile, the artemisia selengensis extract can also up-regulate the expression of a neural development gene (alpha 1-tubulin, mbp) so as to improve the neural development disorder of the zebrafish; besides, the mechanism of improving the zebrafish neurodevelopmental disorder by the artemisia selengensis extract is mainly realized through a p38 / 5-HT / Wnt / beta-catenin signal channel, expression of p38a is down-regulated (network pharmacology finds that p38 in MAPHK is a main mechanism channel), and expression of htr1aa, maoa, wnt4a and beta-catenin is down-regulated.

A system for determining a concentration of an analyte, such as B-type natriuretic peptide (BNP), in a fluid sample, such as a blood sample, includes a sample cartridge, a sensor reader, and a data processing system. The cartridge comprises a sample chamber with an electrochemical sensor, such as a carbon nanotube thin film sensor, and a connector for coupling with the sensor reader. The sensor reader is operable to perform impedance spectroscopy sweeps on the sensor at preconfigured time intervals to generate a set of temporal impedance spectra, which is communicated to the data processing apparatus. The latter operates a trained machine learning model on the set of temporal impedance spectra to generate the concentration of the analyte in the fluid sample. The system enables convenient and reliable point-of-care analyte concentration determination for prognostication of a patient condition.

Provided are long-acting atrial natriuretic peptide (ANP) polypeptides that bind to natriuretic peptide receptors, such as NPR-A, thereby functioning as NPR-A agonists and that exhibit improved stability. The present invention provides atrial natriuretic peptides with specific structural features that result in polypeptides with sufficient activity at NPR-A and also possess a number of other beneficial attributes related to their potential development as therapeutic treatments, including improved solubility of the analogs in aqueous solution, improved chemical and physical formulation stability, an enhanced pharmacokinetic profile, and minimized potential immunogenicity.

The invention discloses a method for efficiently producing general type CAR-T. The general type CAR-T. Specifically, the invention provides a method for efficiently producing universal CAR-T. The method comprises the following steps: (s1) providing a T cell to be edited, and carrying out activated culture on the T cell to obtain an activated T cell; (s2) gene introduction: transfecting the activated T cell by using the LVV integrated with the CAR gene so as to obtain the T cell of which the genome is integrated with the CAR gene; (s3) gene knockout: transfecting the T cell obtained in (s2) by using LNP (Leukocyte Natriuretic Peptide) coated with Cas9mRNA (Cas9 Messenger Ribonucleic Acid) and sgRNA (Single Guide Ribonucleic Acid) so as to obtain a T cell in which the TCR gene and the CD7 gene are knocked out; and (s4) culturing the T cells obtained in the step (s3) so as to obtain the universal CAR-T. According to the method, the UCAR-T production cost can be remarkably reduced, the preparation period is shortened, and commercialization of shelf-type cell therapy is promoted.

The invention relates to the technical field of biological medicines, and provides a method for reducing acetonitrile residues in a recombinant human brain natriuretic peptide stock solution, which comprises the following steps: sequentially carrying out purification chromatography and ultrafiltration treatment on the human brain natriuretic peptide stock solution; during purification chromatography, a mobile phase comprises a phase A and a phase B; the phase A is a mixed solution of citric acid and sodium citrate; and the phase B is a mixed solution of citric acid, sodium citrate and sodium chloride. A chromatographic system is utilized, the recombinant human brain natriuretic peptide is adsorbed on a chromatographic medium under a specific mobile phase condition, then the chromatographic medium is switched to a proper B-phase buffer solution for elution, and in the process, acetonitrile is effectively separated and removed due to the adsorption characteristic difference between the acetonitrile and the recombinant human brain natriuretic peptide on the chromatographic medium. According to the technical scheme, the problem that the residual amount of acetonitrile in the recombinant human brain natriuretic peptide stock solution in related technologies is large is solved.

To provide a type C natriuretic peptide and a method for treating acute lung injury. [Solution] This disclosure relates to the treatment of lung, liver, and / or kidney disorders by administering therapeutically effective doses of (ultra)long-acting C-type natriuretic peptide (CNP), CNP derivatives, (ultra)long-acting CNP derivatives, or (ultra)long-acting CNP receptor (NPRB) agonists to subjects in need. This disclosure also relates to the treatment of non-cardiovascular causes of hypoxia, elevated inflammatory cell levels in the lungs, pulmonary edema, sepsis, bacteremia, fibrosis in general, and / or interstitial lung disease using these.

Methods and materials for treating mammals having cardiovascular and / or metabolic disease are provided herein. For example, methods and materials for treating mammals having cardiovascular and / or metabolic disease by administering (a) an analog of a natriuretic peptide (NP), such as atrial natriuretic peptide (ANP) or dendroaspis natriuretic peptide (DNP), and (b) a glucagon-like peptide-1 (GLP-1) receptor / glucose-dependent insulinotropic polypeptide (GIP) receptor agonist are provided herein. The NP analogs used in the methods provided herein can be less than 20 amino acids in length and, in some cases, can have one or more variations in their ring portion (as compared to wild type ANP or DNP) that affect the potency of the analog in activating the particulate guanylyl cyclase (GC-A) receptor.

The invention discloses a B-type natriuretic peptide stabilizer as well as a preparation method and application thereof. The stabilizer is prepared from the following components: 10 to 90 v / v percent of human serum matrix, 5 to 25 g / L of trehalose, 10 to 25 g / L of mannitol, 1 to 5 mM of N-acetylcysteine, 1.0 to 2.5 g / L of fish gelatin, 0.02 to 0.1 v / v percent of preservative and 0.02 to 0.1 v / v percent of 5-bromo-5-nitro-1, 3-dioxane. The stabilizer can improve the stability of the B-type natriuretic peptide BNP in the serum-containing stabilizer, greatly improves the storage stability, effectively prolongs the shelf life of an independent quality control product for in-vitro diagnosis, and improves the commercial value; and meanwhile, the qualitative change resistance in the preparation and storage processes is improved, and the batch-to-batch difference caused by a freeze-drying process is reduced.

This disclosure relates to a drug delivery system comprising an intraocular pressure lowering agent, a neurotrophic agent, such as a CNTF compound, a C-type Natriuretic Peptide (CNP) compound, a Tie-2 agonist, a Natriuretic Peptide Receptor-B (NPR-B) compound, or an apoptosis signaling fragment inhibitor (FAS) or FAS-ligand (FASL) inhibitor, including any combination of these compounds and a sustained delivery component. Methods of treating a glaucoma or related conditions, medicaments, kits, uses and methods of manufacturing are also described.

[Solution] By using a naturally occurring substance, heart disease such as a myxomatous mitral valve disease is more effectively suppressed without impairing the health of small animals. [Effects] An agent contains, as main ingredients, 5 to 9 wt% of a pine bark dry extract derived from bark of pine trees grown on the southwestern coast of France under exposure to intense ultraviolet light and containing proanthocyanidin, and 5 to 9 wt% of a fermented sesame dry extract containing sesamin, one of the antioxidant lignans, the fermented sesame dry extract mainly containing sesame as a main raw material, and contains 79 to 87 wt% of an excipient such as starch or lactose, as a raw material, which makes a powder uniform, solidifies a tablet, and prevents quality deterioration due to moisture absorption or the like, such as starch or lactose.

The invention discloses an antibody for resisting N-terminal B-type pro-natriuretic peptide and application of the antibody, and relates to the field of antibodies. The anti-N-terminal B-type pro-natriuretic peptide antibody disclosed by the invention comprises a heavy chain complementarity determining region and a light chain complementarity determining region, provides an important raw material source for detection of the N-terminal B-type pro-natriuretic peptide, and has good affinity or activity.

Provided herein are methods of quantifying amounts of N-terminal prohormone B-type natriuretic peptide (NT-proBNP) in whole blood samples. The methods include contacting detection antibody-NT-proBNP complexes with a plurality of capture antibodies, or antigen binding portions thereof, that specifically bind to the NT-proBNP molecules of the detection antibody-NT-proBNP complexes to form captured NT-proBNP complexes, and contacting NPs that each comprise a second recognition moiety that binds to the first recognition moiety of the detection antibodies, or antigen binding portions thereof, of the captured NT-proBNP complexes to form captured NP-NT-proBNP complexes. The methods also include taking images of the captured NP-NT-proBNP complexes to produce imaged captured NP-NT-proBNP complexes using a detection mechanism, and quantifying an amount of NT-proBNP in the sample aliquots using the imaged captured NP-NT-proBNP complexes. Additional methods as well as related devices and systems are also provided.

The utility model discloses a multi-factor combined inspection kit for cardiovascular diseases. The multi-factor combined inspection kit comprises a reagent card and a sample treatment box, a uniform mixing cavity is formed in the sample treatment box, and a reagent card slot and a sample adding hole are formed in the sample treatment box; a sample treatment liquid is preloaded in a mixing cavity of the sample treatment box; the multiple factors comprise four factors, namely cardiac troponin I, peptidin, an amino-terminal brain natriuretic peptide precursor and a D-dimer; the reagent card comprises a bottom plate, a sample pad, a detection pad and a sample suction pad. The sample treating fluid contains a fluorescence-labeled specific detection antibody aiming at the four factors and a fluorescence-labeled quality control detection antibody. The kit can be used for quantitatively detecting four indexes of cardiac troponin, peptidin, amino-terminal brain natriuretic peptide precursor and D-dimer within 15 minutes at the same time, is simple to operate and accurate in result, and is suitable for outpatient and emergency treatment of hospitals and primary medical institutions.

A method for detecting hBNP, or a precursor or a degradation product of the same, in a sample according to one aspect of the present invention comprises a step for detecting, by a latex coagulating method, hBNP, or a precursor or a degradation product of the same, in the sample by using: a monoclonal antibody that recognizes an amino acid region at positions 17-24 in the amino acid sequence indicated by SEQ ID NO. 1, or an antigen binding fragment of the monoclonal antibody; and a monoclonal antibody that recognizes an amino acid region at positons 5-13 in the amino acid sequence indicated by SEQ ID NO. 1, or an antigen binding fragment of the monoclonal antibody. The precursor of hBNP is hproBNP, and the degradation product of hBNP is a degradation product including an amino acid region at positions 5-24 in the amino acid sequence indicated by SEQ ID NO. 1. According to the present invention, it is possible to detect hBNP by using a latex coagulating method while suppressing effects caused by steric hindrance of antibody-immobilized latex particles and degradation of terminals of hBNP.

The invention provides a C-type natriuretic peptide (CNP) variant, wherein the amino acid sequence of the CNP variant is LQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (CNP-38), a conjugate comprising the CNP variant and a hydrophilic polymer, and their use for the treatment of a bone-related disorder or skeletal dysplasia.

The invention relates to a traditional Chinese medicine composition for treating ischemic heart failure and a preparation method thereof, and belongs to the field of traditional Chinese medicine pharmacy, and the traditional Chinese medicine composition is prepared from the following raw material medicines in parts by weight: 5-15 parts of cassia twig, 5-15 parts of bighead atractylodes rhizome, 5-15 parts of poria cocos, 6-12 parts of rhizoma zingiberis, 5-15 parts of acanthopanax, 10-30 parts of fructus polygoni orientalis, 3-9 parts of verbena, 6-12 parts of dogwood and 3-9 parts of honey-fried licorice root. The composition can remarkably reduce the level of N-terminal proB-type natriuretic peptide, remarkably improve pathological changes of heart tissues of model rats, regulate and control the heart functions of the model rats, improve the systolic function of the heart, relieve expression of inflammatory factors such as interleukin-1beta, interleukin-6 and tumor necrosis factor-alpha of the rats and improve the anti-inflammatory effect of the rats. The action mechanism of the compound relates to a plurality of pathways such as extracellular matrix receptor interaction, a chemotactic factor signal pathway, a relaxin signal pathway, a cyclic adenosine monophosphate signal pathway, a nuclear factor-kB signal pathway, fatty acid metabolism and a Toll-like receptor signal pathway, and the compound is an effective medicament for treating ischemic heart failure.

Methods and materials for treating or preventing cardiotoxicity and / or hypertension induced by one or more anti-cancer agents (e.g., tyrosine kinase inhibitor (TKI) -induced cardiotoxicity (e.g., sunitinib-induced cardiotoxicity) and / or TKI-induced hypertension (e.g., sunitinib-induced hypertension)) are provided herein. For example, provided herein are methods for using polypeptides (e.g., chimeric polypeptides) that include (a) one or more natriuretic peptides and (b) one or more angiotensin 1-7 (ANG1-7) polypeptides to treat or prevent cardiotoxicity and / or hypertension induced by one or more anti-cancer agents.

The invention discloses an application of a natriuretic peptide combined cardiac enzyme in diagnosis of diabetic cardiomyopathy, which is implemented by detecting the change conditions of a natriuretic peptide MR-proANP and a cardiac enzyme Corin in the plasma of a patient with diabetic cardiomyopathy, and also discloses an application of the natriuretic peptide combined cardiac enzyme in preparation of a diagnostic reagent for diabetic cardiomyopathy. The problems that proANP is extremely unstable in peripheral blood, and missed diagnosis and misdiagnosis are easily caused are solved.

The invention discloses a preparation method of glycosylated brain natriuretic peptide precursor protein, a brain natriuretic peptide quality control product, a kit and application of the brain natriuretic peptide quality control product. The preparation method comprises the following steps: inserting a target gene of the brain natriuretic peptide precursor protein into a plasmid to construct a recombinant expression vector; transforming the recombinant expression vector into pichia pastoris, performing fermentation culture, and collecting fermentation liquor; and purifying the fermentation liquor to obtain the glycosylated brain natriuretic peptide precursor protein. According to the preparation method, the expressed protein can be subjected to glycosylation modification by using a pichia pastoris expression system, and the expression quantity is high, so that the glycosylation ProBNP with a longer sequence and a longer half-life period is obtained, the problems that in a traditional BNP preparation process, the maturity of the protein expressed by escherichia coli is not high and the protein is different from a natural sample are solved, and the preparation method is suitable for industrial production. And the difficulty in process amplification of mammalian cell expression protein is also avoided.

Short analogues of natriuretic peptides (NPs) are provided herein. For example, analogues of atrial natriuretic peptide (ANP) and Dendroaspis natriuretic peptide (DNP) that are less than 20 amino acids in length are provided herein. In some cases, the analogues have one or more variations in their ring portion, as compared to wild type ANP or DNP, that can affect the potency of the analogues in activating the GC-A receptor. In addition, methods for using the analogues described herein to treat mammals having, for example, cardiovascular, cardiorenal, and / or metabolic disease are provided herein.

The invention provides a cracking process of G-type natriuretic peptide, which is used for cracking synthesized G-type natriuretic peptide resin to obtain a linear peptide crude product, and comprises the following steps: S41, preparing a cracking reagent; s42, performing concentration; s43, carrying out precipitation; s44, filtering is carried out; and S45, drying. The cracking reagent comprises the following components: TFA, H2O, EDTA, TIS, ArOH and ArSCH3, wherein the ratio of TFA to H2O to EDTA to TIS to ArOH to ArSCH3 is 81.5: 5: 2.5: 1: 5: 5 (V / V / V / V / W / V). The dosage ratio of the cracking reagent to the G-type natriuretic peptide resin is 12-15ml / g. And carrying out suction filtration on the cracked reaction liquid, washing with TFA (Trifluoroacetic Acid), combining washing liquids, carrying out reduced pressure concentration on the filtrate at 32 + / -3 DEG C until the volume is 30-40% of the initial volume, and then precipitating with methyl tert-butyl ether. The cracking process of the G-type natriuretic peptide has the advantages that the cracking yield is high and can reach 20.0-30.0%, a stable and reliable process is provided for chemical synthesis of GNP cracking, and a high-quality cracking product is provided for subsequent preparation of GNP raw material medicines.

The invention relates to the technical field of medicine, in particular to a composition containing an angiotensin II receptor blocker and application of the composition in heart disease dilation medicine. The composition comprises an angiotensin converting enzyme inhibitor and an angiotensin II receptor blocker, and a small dose of ACEI and a large dose of ARB are combined to be used for dilating the heart disease. The traditional Chinese medicine composition has excellent effects in the aspects of reducing the left ventricular end diastolic anterior-posterior diameter or left-right diameter, plasma brain natriuretic peptide precursor (NT-pro BNP) plasma level, pulmonary arterial pressure and left ventricular ejection fraction, does not influence the normal levels of physiological indexes such as blood potassium, serum creatinine, urea nitrogen, alanine aminotransferase (ALT) and asparaginic acid aminotransferase (AST), and can be used for preparing a medicine for treating the left ventricular end diastole. The medicine can be applied to heart disease dilation medicines.

To provide a method of measuring an N-terminal fragment of a human brain natriuretic peptide precursor, which reduces the effect of a duration from collection of a sample till detection on separation property of a complex, and to provide a measurement kit for implementing the above method.SOLUTION: A method of measuring a human brain natriuretic peptide precursor N-terminal fragment in a sample is provided, the method comprising separating a complex containing the human brain natriuretic peptide precursor N-terminal fragment and a substance binding to the human brain natriuretic peptide precursor N-terminal fragment in the presence of a polyanionic polymer, and measuring the complex, where the concentration of the polyanionic polymer in a separation medium is 5.1% (w / v) or greater.SELECTED DRAWING: None

A synthetic protein comprising: an N-terminal collagen-binding domain (CBD); a C-terminal C-type natriuretic peptide domain (CNP); and optionally, a spacer linking the CBD and the CNP.

The invention provides a purification process of G-type natriuretic peptide. The purification process comprises the following steps: S5, treating a GNP cracking intermediate crude product; s6, first-step purification: taking 0.2% TFA.H2O as a mobile phase A and acetonitrile as a mobile phase B, preliminarily separating the oxidized crude product solution obtained in the step S5, collecting to obtain a component 1, a component 2 and a component 3, and continuously and circularly purifying the component 1 and the component 3 until the component 2 is obtained; s7, second-step purification: a mobile phase A is 50mmol / L Na2SO4, the pH is 2.3, a mobile phase B is acetonitrile, the mobile phase A is used for purifying and separating the component 2 collected in the step S6 into components 4-6, and the component 4 and the component 6 continue to be circularly purified into a component 5; s8, third-step purification: a mobile phase A is 50mmol / L Na2SO4, the pH is 2.3, a mobile phase B is acetonitrile, the mobile phase A is used for purifying and separating the component 5 collected in the step S7 into components 7-9, the component 7 and the component 9 are continuously and circularly purified into a component 10, and the component 10 is recycled to the component 8; s9, purification in the fourth step: a mobile phase A is 0.2% HAC.H2O, and a mobile phase B is acetonitrile. The problems that GNP obtained through chemical synthesis is low in purity and poor in yield are solved.

Provided is a chimeric natriuretic peptide or a variant thereof. The chimeric natriuretic peptide comprises or consists of an N-terminal extension fragment, a cyclic fragment and a C-terminal extension fragment from the N-terminus to the C-terminus. The N-terminal extension fragment is truncated from an N-terminal linear region of DNP or an N-terminal linear region of ANP; the cyclic fragment is formed by truncating an N-terminal linear region and a C-terminal linear region of BNP while retaining a cyclic region thereof; and the C-terminal extension fragment is truncated from a C-terminal linear region of DNP. The chimeric natriuretic peptide has enhanced cGMP activation ability. Further provided are a fusion protein, nucleic acid molecule, recombinant vector, host cell, immunoconjugate and pharmaceutical composition of the chimeric natriuretic peptide or the variant thereof, and the related use thereof.