113 results about "Dysplasia" patented technology

Provided herein is technology for esophageal disorder screening and particularly, but not exclusively, to methods, compositions, and related uses for detecting the presence of esophageal disorders (e.g., Barrett's esophagus, Barrett's esophageal dysplasia, etc.). In addition, the technology provides methods, compositions and related uses for distinguishing between Barrett's esophagus and Barrett's esophageal dysplasia, and between Barrett's esophageal low-grade dysplasia, Barrett's esophageal high-grade dysplasia, and esophageal adenocarcinoma within samples obtained through endoscopic brushing or nonendoscopic whole esophageal brushing or swabbing using a tethered device (e.g. such as a capsule sponge, balloon, or other device).

The invention features ALK2 antibodies and antigen binding fragments thereof (e.g., ALK2 binding fragments). The invention also features pharmaceutical compositions and methods of using the ALK2 antibodies or antigen binding fragments thereof to treat bone disease or damage, low red blood cell levels (e.g., anemia or blood loss), heterotopic ossification (e.g., heterotopic ossification resulting from fibrodysplasia ossificans progressiva), Sjogren's syndrome (e.g., dry eye associated with Sjogren's syndrome), multiple osteochondroma, diffuse intrinsic pontine glioma, posterior capsule opacification, or cardiac hypertrophy and / or cardiac fibrosis.

The present invention relates to a device for treating dysplasia, tumours and / or bacterial and viral infections, comprising a first laser (20), at least one second laser (30), a wavelength combiner (40) for combining the radiation emitted from the first laser and the second laser, and an optical supply apparatus (50), wherein the optical supply apparatus is connected to the wavelength combiner and is configured to supply the radiation combined in the wavelength combiner to a treatment region, wherein the first laser (20) is configured to emit narrow-band radiation at a first wavelength from the ranges from 400 nm to 420 nm, preferably 410 nm, 440 nm to 460 nm, preferably 450 nm, 520 nm to 540 nm, preferably 530 nm, 620 nm to 640 nm, preferably 630 nm, 645 nm to 675 nm, preferably 660 nm, 680 nm to 700 nm, preferably 690 nm, 745 nm to 775 nm, preferably 760 nm, 800 nm to 820 nm, preferably 810 nm, 910 nm to 930 nm, preferably 920 nm, 970 nm to 990 nm, preferably 980 nm, 1035 nm to 1100 nm, preferably 1065 nm, 1460 nm to 1490 nm, preferably 1470 nm or 1930 nm to 1950 nm, preferably 1940 nm, and the second laser (30) is configured to emit narrow-band radiation at a second wavelength from the range from 1262 nm to 1272 nm, preferably 1264 nm to 1270 nm, particularly preferably 1267 nm.

The present invention relates to FGFR3 inhibitor compounds of novel structure or pharmaceutically acceptable salts, isotope variants, tautomers, stereoisomers or prodrugs thereof, and their use as medicine. The compounds are useful in the treatment of cancers such as urothelial carcinoma, systemic sclerosis, fibrosis, pulmonary fibrosis, cartilage insufficiency, lethal insufficiency, severe cartilage insufficiency accompanied by developmental retardation and atrachis ossicular, or muenke syndrome. # imgabs0 #

The invention relates to compositions containing selenite-containing compounds and pharmaceutically acceptable acids, selected from citric acid, acetic acid, malic acid, carbonic acid, sulphuric acid, nitric acid, hydrochloric acid, fruit acids or mixtures thereof, for use for treating cervical inflammations, dysplasia and / or carcinomas. The invention further relates to methods of using such compositions.

Provided herein are methods for diagnosing and treating a pulmonary disease, e.g., bronchopulmonary dysplasia (BPD) using proteomics analysis.

The present invention provides methods and compositions for the treatment of chronic lung disease (CLD), comprising administering to a subject in need of treatment a composition comprising insulin-like growth factor-1 (IGF-1).

The present application relates to a method for extracting an acetabular facies lunata model, in particular to a method for extracting an acetabular facies lunata model based on mixed surface fitting, which solves the technical problem of low precision and robustness of the existing method for extracting an acetabular facies lunata model. The present application realizes rough extraction of the acetabular facies lunata model through spherical surface fitting, and then realizes accurate extraction of the acetabular facies lunata model in combination with ellipsoidal surface fitting, which combines the stability of spherical surface fitting and the anatomical fidelity of ellipsoidal surface fitting. In particular, in the case of complex pathologies such as hip dysplasia, the present application can still maintain high extraction accuracy, and improve the accuracy and reliability of clinical diagnosis and surgical planning. Meanwhile, in the iteration process of ellipsoidal surface fitting, an adaptive fault tolerance threshold is introduced, which effectively solves the problems of sensitivity to noise and strong parameter dependence of traditional methods, and has better robustness in processing complex acetabular morphology.

The invention discloses a bronchial lung dysplasia severity prediction method and related equipment, and belongs to the technical field of machine learning, and the method comprises the steps: obtaining the clinical data of a target object; preprocessing the clinical data of the target object, constructing a training set and a verification set according to a preset proportion, and screening to obtain a target variable; based on the target variable, constructing a plurality of bronchial lung dysplasia severity prediction models by using the training set, and performing model performance evaluation on the plurality of constructed bronchial lung dysplasia severity prediction models in the verification set; and obtaining a bronchial lung dysplasia severity prediction model with the optimal performance so as to complete bronchial lung dysplasia severity prediction. The clinical data of the target object is combined with the machine learning algorithm, so that the dynamic change of the immune system of the premature infant can be reflected more comprehensively, the prediction accuracy of the severity of early bronchial pulmonary dysplasia is improved, and scientific data support is provided for clinical treatment selection.

Provided herein is technology for pancreatic high-grade dysplasia screening and particularly, but not exclusively, to methods, compositions, and related uses for detecting the presence of pancreatic high-grade dysplasia (IPMN-HGD, PanIN-3, or PDAC).

The present invention discloses a method for constructing a fetal osteoarthritis model caused by prednisone exposure during pregnancy, an intervention target, and its application. circGtdc1 is a newly identified circRNA that is most significantly altered in dysplastic cartilage caused by prednisone exposure during pregnancy. RNase R, AcD, and Sanger sequencing confirmed its circularization. Prednisolone concentration-dependently reduced circGtdc1 expression in chondrocytes. Silencing circGtdc1 significantly inhibited chondrocyte proliferation and matrix synthesis gene expression, while overexpression of circGtdc1 had the opposite effect and could reverse the effects of prednisolone. Intra-articular injection of AAV‑circGtdc1 to overexpress circGtdc1 can reverse chondrodysplasia caused by prednisone exposure during pregnancy. The intervention target established by the present invention is novel, reliable, and simple, providing a possibility for the early prevention and treatment of fetal osteoarthritis.

A system and method configured to better identify patient-specific anatomical landmarks, measure anatomical parameters and features, and predict the patient's need for surgery within a predetermined time period. In some embodiments, the system and method is configured to predict the likelihood or risk that a patient will require total hip arthroplasty. In some embodiments, the present invention includes machine learning technology Some embodiments of the present invention include a first ML machine configured to received medical images as inputs and identify anatomical landmarks as outputs; a measurement module to measure joint space width, hip dysplasia angles, and / or leg length differential; and a second ML machine configured to receive the anatomical measurements and patient demographic data as inputs and produce a risk or likelihood that the patient will require surgery within a certain time frame.

The present invention provides a hip joint anatomical site prediction system, a pre-operative and post-operative evaluation system, and a storage medium, belonging to the technical field of medical data processing. The system of the present invention includes: an input module for inputting the hip joint image data to be recognized of a patient; a data processing module for inputting the hip joint image data to be recognized into a deep learning network model to obtain the anatomical sites and anatomical regions in the hip joint image data to be recognized; an output module for outputting the recognized anatomical sites and anatomical regions, calculating parameters according to the anatomical sites and anatomical regions, and outputting a predicted pre-operative plan or post-operative evaluation based on anatomical information. The system of the present invention has high accuracy and robustness, not only improves the surgical efficiency of clinical hip dysplasia, but also promotes the digitization of the pre-operative planning and post-operative evaluation systems for total hip arthroplasty, reduces the burden on patients, is conducive to standardizing parameters, and has broad application prospects.

The present disclosure provides compositions and methods for distinguishing between non-cancerous, pre-cancerous, and cancerous conditions in the esophagus. In particular, the present disclosure provides compositions and methods for distinguishing non-dysplastic Barrett's esophagus (NDBE) samples from pre-cancerous (e.g., low-grade or high-grade dysplasia) and / or cancerous (e.g., esophageal adenocarcinoma) samples based on methylation status and / or DNA copy number abnormalities.

This invention relates to a nutritional composition for promoting bone development and its applications. The invention provides applications of the nutritional composition or preparations comprising said nutritional composition, including: (1) preparing food products; (2) preparing health products for promoting bone development, increasing height, and / or improving bone density; (3) preparing drugs or drug compositions for promoting bone development, increasing height, increasing bone density, treating or preventing osteoporosis, and / or treating or preventing skeletal dysplasia; and (4) promoting bone development, increasing height, and / or improving bone density for non-therapeutic purposes; wherein said nutritional composition comprises medium- and long-chain triglycerides (MLCT) and 1,3-diunsaturated fatty acid-2-palmitoyltriglycerides (UPU).

The present disclosure provides methods, uses, and pharmaceutical compositions with utility in the treatment of acute lung injuries or chronic lung diseases including, bronchopulmonary dysplasia and exacerbations of bronchopulmonary dysplasia.

The present invention relates to a CNP or CNP conjugate or a pharmaceutically acceptable salt thereof or a pharmaceutical composition comprising such CNP or CNP conjugate or a pharmaceutically acceptable salt thereof for use in the treatment of a lower extremity deformity in a subject with a skeletal dysplasia and wherein the subject has or is at risk of developing said lower extremity deformity and related aspects.

1. The name of the product of this design: mandibular prosthesis (PEEK polyetheretherketone). 2. Purpose of the product of this design: to repair mandibular bone defect and mandibular bone surface dysplasia. 3. The design key point of this appearance design product lies in the shape. 4. The picture or photo that best illustrates the design key points: 3D image of component 1.

Provided herein is technology for esophageal disorder screening and particularly, but not exclusively, to methods, compositions, and related uses for detecting the presence of esophageal disorders (e.g., Barrett's esophagus, Barrett's esophageal dysplasia, etc.). In addition, the technology provides methods, compositions and related uses for distinguishing between Barrett's esophagus and Barrett's esophageal dysplasia, and between Barrett's esophageal low-grade dysplasia, Barrett's esophageal high-grade dysplasia, and esophageal adenocarcinoma within samples obtained through endoscopic brushing or nonendoscopic whole esophageal brushing or swabbing using a tethered device (e.g. such as a capsule sponge, balloon, or other device).

The invention belongs to the technical field of biological medicine, and particularly relates to a serum exosome circular RNA marker and application thereof. The invention relates to a serum exosome circular RNA (Ribonucleic Acid) marker for diagnosing or predicting bronchial lung dysplasia of a premature infant. The circular RNA marker is selected from at least one of the following components: hsacirc0001522; the molecular marker is Hsacirc0001359. By finding differentially expressed cyclic rna in serum exosomes of BPD infants and non-BPD infants on the 7th day, the 14th day and the 28th day, cyclic rna is differentially expressed in the serum exosomes of the BPD infants and the non-BPD infants. The invention relates to the field of biomarkers, in particular to hsacirc0001359, which can be used as a very promising and easily available biomarker and can be used for predicting BPD on the seventh day after birth.

The invention relates to a computer-implemented method for detecting oesophageal squamous cell dysplasia (OSCD) or oesophageal squamous cell cancer (OSCC) in a cell sample from a subject. This invention also relates to a computer-implemented method for generating a trained model to detect OSCD or OSCC. This invention also relates to a computer-readable storage medium or a computer program comprising instructions which when executed by a computer, are capable of causing the computer to perform the method. This invention also relates to a kit comprising the computer program or computer-readable storage medium and a non-endoscopic cell collection device. The invention also relates to an apparatus for performing the method. The invention further relates to the use of genome wide instability scores (GWIS) as a diagnostic marker for cancer, wherein GWIS is a measure of the CNV across a plurality of autosomal arms in a cell sample from a subject.

The invention provides a computer-implemented method for assisting diagnosis of dysplasia from a liquid-based cytology whole-slide image (WSI), using a multi-stage pipeline combining deep- learning-based detection with engineered feature extraction and a calibrated machine-learning classifier. The method involves receiving and resampling a digital WSI to a canonical spatial resolution, detecting individual cell instances with a neural network, computing morphological and texture features for each detected cell, aggregating these features across the WSI to form a slide-level feature vector, inputting this vector into a calibrated classifier to yield a slide-level probability of dysplasia, computing slide-quality metrics to govern downstream triage, presenting results via an interactive graphical interface with per-cell thumbnails, and iteratively refining the system with expanded and harmonized training data from expert annotations.

The invention belongs to the technical field of gene engineering, and particularly relates to a construction method of a ribosomal disease zebrafish model. The invention provides a construction method of a ribosomal disease zebrafish model, which comprises the following steps: directionally mutating a pno1 gene in a wild zebrafish embryo to obtain F0-generation zebrafish; mating the F0-generation zebrafish with wild type zebrafish, and screening out positive heterozygote F1-generation zebrafish from birth zebrafish as the ribosomal disease zebrafish model. The zebrafish mutant is constructed through the targeted ribosomal factor gene, multi-system phenotypes of hematopoietic system defects, skeletal insufficiency and digestive system dysplasia can be reproduced at the same time, the problem that in the prior art, disease phenotypes are incomplete is solved, and the zebrafish mutant can be widely applied to pathogenesis research and drug screening of ribosomal diseases and has a wide application prospect. An important platform is provided for developing a novel treatment means.

The present disclosure provides methods and formulations for treating a patient suffering from one or more of chronic inflammatory injury, metaplasia, dysplasia or cancer of esophageal tissue and gastric tissue, which method comprises administering to the patient an agent that selectively kills or inhibits the proliferation or differentiation of pathogenic Barrett's Esophagus stem cells (BESCs) or Gastric Intestinal Metaplasia stem cells (GIMSCs) relative to normal regenerative esophageal stem cells or gastric stem cells in the tissue in which the BESCs or GIMSCs are found.

The invention relates to the technical field of child hip joint development prediction, in particular to a child hip joint development prediction method and device.In the embodiment of the invention, firstly, a hip joint two-dimensional ultrasonic image is input into a first prediction model, and the normal distribution probability and the prediction value of the child hip joint development week age number are predicted; a hip three-dimensional model is constructed through the hip joint two-dimensional ultrasonic image, and three groups of acetabulum dysplasia evaluation factors in three dimensions are obtained based on the hip three-dimensional model; and finally, integrating the children clinical information, the children hip joint development week age prediction result and the acetabular dysplasia evaluation factor to obtain a prediction result of the children hip joint development condition.

The present invention relates to a method for promoting wound healing in a subject suffering from Ectodermal dysplasia in need thereof comprising a step of administering subcutaneously, intradermally or topically to said subject a therapeutically effective amount of a compound which restores the activity of p63. Inventors have performed a primary culture of patient keratinocytes suffering from ectodermal dysplasias with two compounds which restore the activity of p63 (e.g. STIMA-1 and / or PRIMA-1Met). They have shown that there is an important differentiation of the keratinocytes of said patient compared to the cells not treated with these compounds. They observed that the activity of p63 mutated is restored, thus the proliferation and differentiation of keratinocytes from the patient are activated. Moreover, inventors have used PRIMA-1Met by topical application on a young patient suffering from ectodermal dysplasias and shown that said patient presents an improvement on her hand. Typically, severe skin erosions (on hands and feet) are healing when PRIMA-1Met is administered topically on the hand.

The invention discloses a method for constructing a Bardet-Biedl syndrome kidney cell model, which comprises the following steps of: constructing a Bardet-Biedl syndrome kidney cell model; the invention relates to the technical field of biology, and provides a method for constructing a Bardet-Biedl syndrome kidney cell model, which comprises the following steps: directionally inducing and differentiating a specific induced pluripotent stem cell into a kidney cell population, and obtaining the kidney cell population, namely the Bardet-Biedl syndrome kidney cell model, the specific induced pluripotent stem cells are derived from BBS7 gene carrying c.849 + 1Ggt; c, and c.754Ggt; the in-vitro peripheral blood mononuclear cells of a Bardet-Biedl syndrome patient with A and A composite heterozygous mutation are reprogrammed to obtain the in-vitro peripheral blood mononuclear cells of the Bardet-Biedl syndrome. The cell model disclosed by the invention can reflect clinical manifestations of kidney dysplasia and dysplasia of cilia of a Bardet-Biedl syndrome patient, so that a platform is provided for a pathogenic mechanism of the disease, drug screening and even gene therapy.

The invention provides a C-type natriuretic peptide (CNP) variant, wherein the amino acid sequence of the CNP variant is LQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (CNP-38), a conjugate comprising the CNP variant and a hydrophilic polymer, and their use for the treatment of a bone-related disorder or skeletal dysplasia.

The present invention relates to detecting esophageal diseases. Provided herein are techniques for screening for esophageal diseases, particularly but not exclusively, methods, compositions, and related uses for detecting the presence of esophageal diseases (e.g., Barrett's esophagus, Barrett's esophagus dysplasia, etc.). In addition, the present technology provides methods, compositions, and related uses for distinguishing between Barrett's esophagus and Barrett's esophagus dysplasia, as well as low-grade dysplasia, high-grade dysplasia, and esophageal adenocarcinoma in samples obtained by endoscopic brushing or non-endoscopic whole esophageal brushing or swabbing using a tethered device (e.g., a capsule sponge, balloon, or other device).

1. The name of this design product: eyebrow arch (PEEK polyetheretherketone). 2. Purpose of the product of this design: to repair brow bone defect and brow bone hypoplasia. 3. The design key point of this appearance design product lies in the shape. 4. The picture or photo that best illustrates the key points of the design: 3D drawing of Design 1. 5. Designate Design 1 as the base design.