Antigen-binding fragment of humanized anti-CD19

A technology of binding fragments and humanization, applied in the direction of DNA/RNA fragments, medical raw materials derived from mammals, anti-receptor/cell surface antigen/cell surface determinant immunoglobulin, etc.

Active Publication Date: 2019-12-17
GUANGZHOU BIO GENE TECH CO LTD
View PDF7 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0006] Among the more than 50 CD19-targeting CAR-T clinical trials registered globally, there is only one clinical trial targeting CD19 humanized CAR-T

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Antigen-binding fragment of humanized anti-CD19
  • Antigen-binding fragment of humanized anti-CD19
  • Antigen-binding fragment of humanized anti-CD19

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0062] Example 1 Homology Modeling of Murine Antibody FMC63 scFv Chain

[0063] a. The principle of homology modeling is that similar sequences lead to similar structures, and the conservation of structures is much greater than that of sequences.

[0064] (1) First, search and compare homologous sequences in the NCBI database, and select a sequence with high homology to the amino acid sequence of the FMC63 scFv chain as a homologous template. The selected sequence should at least meet the following three conditions: ① Sequence The similarity should be greater than 30%; ② High sequence identity and E value should be small enough (figure 1 shown.

[0065] The homologous template selected in the present invention is the crystal structure of the mouse monoclonal antibody Fab, and the PDB database number is: 4EDX.

[0066] After the sequence alignment was completed, the Antibody Modeler module of the MOE software was used to perform homology modeling on the FMC63 scFv chain, and A...

Embodiment 2

[0082] Example 2. IgBlast analysis and antigen affinity prediction

[0083] a. The following is the sequence of the light chain variable region of the mouse anti-CD19 antibody FMC63, the underlined part is the mouse anti-framework sequence (FR sequence), and the bold part is the CDR region sequence.

[0084] Seq ID No: 29

[0085] DIQMTQTTSSLSASLGDRVTISCRASQDISKYLNWYQQKPDGTVKLLIYHTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPYTFGGGTKLEIT

[0086] By analyzing the light chain variable region sequence of the mouse anti-CD19 antibody FMC63, the human germline antibody gene library (NCBI IgBLAST) was compared according to its light chain variable region FR1, FR2, FR3 and FR4 and the entire light chain sequence, Find the corresponding sequence of the variable region of the human germline (germline) antibody (less immunogenic than the mature antibody) similar to the sequence of the mouse anti-CD19 light chain variable region FR1, FR2, FR3 and FR4. Figure 4 It is the FR1 sequence c...

Embodiment 3

[0205] Example 3 Synthesis of CAR Gene and Construction of Vector

[0206] Select the five humanized sequences in Example 2, and add the linker sequence (gly4ser)3 between VL and VH in turn, so the structure of the scFv part designed and constructed into the chimeric antigen receptor is: VL-(gly4ser)3- VH. Specifically, the amino acid sequences of the five ScFv obtained are shown in sequence in Seq ID.No.46-Seq ID.No.50; the corresponding nucleic acid sequences are shown in SeqID.No.51-Seq ID.No.55 . details as follows:

[0207] The amino acid sequence of the scFv corresponding to the humanized sequence one (H1) is shown in Seq ID.No.46.

[0208] The amino acid sequence of the scFv corresponding to the humanized sequence 2 (H2) is shown in Seq ID.No.47.

[0209] The amino acid sequence of the scFv corresponding to the humanized sequence three (H3) is shown in Seq ID.No.48.

[0210] The amino acid sequence of the scFv corresponding to the humanized sequence four (H4) is sh...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention provides a composition and a method for treating CD19 expression related diseases. The invention also relates to an application of humanized anti-CD19 single chain antibody with low immunogenicity as a CD19 antigen binding fragment, which is used for constructing a chimeric antigen receptor (CAR) specific to CD19, a carrier for coding the chimeric antigen receptor, and a recombined T-cell containing anti-CD19CAR. The invention also comprises a method for applying a genetically modified T-cell which expresses CAR containing the humanized anti-CD19 antigen binding fragment.

Description

technical field [0001] The invention relates to the field of biotechnology, in particular to a preparation method and application of humanized anti-CD19 chimeric antigen receptor modified T cells. Background technique [0002] In recent years, tumor immunotherapy has entered a stage of rapid development, and CAR-T therapy, as one of the important methods, has achieved very encouraging results in the treatment of hematological malignancies. At present, more and more domestic enterprises, hospitals, and academic institutions are joining in this research field to jointly promote the development of CAR-T therapy and explore a wider range of potential application values. [0003] At present, the antibody recognition sequence in most CD19-targeting CAR-T technologies comes from the mouse source, which may cause strong immunogenicity after reinfusion into the human body, and is easy to be recognized and eliminated by autoimmune cells, affecting CAR- The long-term efficacy of T cel...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityPatents(China)
IPC IPC(8): C07K16/28C07K19/00C12N15/13C12N15/62C12N5/10A61K35/17A61P35/00A61P35/02
CPCA61K35/17C07K14/7051C07K16/2803C07K2317/24C07K2317/56C07K2317/565C07K2317/92C07K2319/02C07K2319/03C07K2319/33
Inventor李光超邱玉信丁雯莫文俊
OwnerGUANGZHOU BIO GENE TECH CO LTD