Screening method of GS (glutamine synthetase) expression system cell strains
An expression system and screening method technology, applied in the field of GS expression system cell line screening, can solve the problems of low cloning efficiency and high requirements for cell growth state, achieve high clone formation rate, improve monoclonal efficiency, and improve screening success. rate effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0022] 1. Construction of expression vector
[0023] (1) Chemically synthesize the monoclonal antibody light and heavy chain DNA sequences containing the CD33 signal peptide sequence and ATG start codon (synthetic manufacturer: GenScript Biotechnology Co., Ltd.), the amino acid sequence of the heavy chain is as shown in SEQ ID NO: 1 where the underline The straight line is the amino acid sequence of CD33 signal peptide:
[0024] MPLLLLLPLLWAGALA EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK。
[0025] The heavy chain DNA sequence is shown in SEQ ID NO: 2, wherein the underlined...
PUM
Abstract
Description
Claims
Application Information
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com