Unlock instant, AI-driven research and patent intelligence for your innovation.

Conformation-specific recombinant aβ1-42-like oligomer antigen, its preparation method and application

A technology of oligomers and antigens, applied in the fields of biopharmaceuticals and genetic engineering, can solve the problems of ineffective neutralization of oligomers, failure to improve cognitive ability, and inability to improve cognitive ability, so as to improve learning The effect of memory ability and great application prospect

Active Publication Date: 2021-06-08
ACADEMY OF MILITARY MEDICAL SCI
View PDF4 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

These completed clinical trials have not achieved the therapeutic effect of improving cognitive ability. The possible reason is that these vaccines mainly produce non-specific antibodies against Aβ oligomers after immunization, and cannot effectively neutralize the effects on synaptic function and neurons. More toxic oligomers (Meli G, et al., Nature Communications, 2014; 5(5):3867.), so that cognitive ability cannot be improved

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Conformation-specific recombinant aβ1-42-like oligomer antigen, its preparation method and application
  • Conformation-specific recombinant aβ1-42-like oligomer antigen, its preparation method and application
  • Conformation-specific recombinant aβ1-42-like oligomer antigen, its preparation method and application

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0066] Example 1. Construction of recombinant prokaryotic expression vector and expression and purification of recombinant Aβ1-42-like oligomer antigen in Escherichia coli

[0067] 1. Design and synthesis of 6×(Aβ1-15-Th) and 12×(Aβ1-15-Th) genes

[0068] According to the codon degeneracy, six copies of the tandem 6×(Aβ1-15-Th) gene (see SEQID No.1) and 12 copies of the tandem 12×(Aβ1-15-Th) gene (see SEQ ID No.2), directly synthesized and cloned into the pMD18-T(TaKaRa)T vector, named pMD18-6×(Aβ1-15-Th) and pMD18-12×(Aβ1-15-Th), respectively encoding 6×(Aβ1-15-Th) and 12×(Aβ1-15-Th) (see SEQ ID No.3 and SEQ ID No.4 for the amino acid sequence), each Aβ1-15-Th is connected with a GS flexible peptide ( figure 1 Middle A). In each Aβ1-15-Th molecule, Aβ1-15 is the B-cell epitope of Aβ1-42 molecule, the sequence is DAEFRHSGYEVHHQ; Th (DAEFRHDSGYEVHHQAKFVAAWTLKAAAQYIKANSK FIGITE) is the helper T-cell epitope, including the universal DR helper T-cell epitope PADRE sequence (AKA...

Embodiment 2

[0079] Example 2. Recombinant Aβ1-42-like oligomer antigen induces normal mice to produce a high level of Th2 anti-Aβ antibody response

[0080] Using the recombinant Aβ1-42-like oligomer antigen protein 6×(Aβ1-15-Th) and 12×(Aβ1-15-Th) expressed and purified in Example 1 as the immunogen, ie subunit vaccine, to immunize mice, to test its immunogenicity. The specific method is as follows: C57 / BL6 mice (8 weeks old, female, SPF level, Experimental Animal Center of Military Medical Research Institute) were randomly divided into 3 groups, 8 mice in each group, and 5 μg of recombinant protein was immunized, while the control group (Control) Immunize with PBS without recombinant protein, and immunize four times in total. Before immunization, the antigen was diluted to a final concentration of 10% (V / V) aluminum adjuvant (Alhydrogel TM , Brenntag Biosector, Frederikssund, Denmark). Intramuscular injection of 100 μl per mouse was used for immunization. For booster immunization, th...

Embodiment 3

[0084] Example 3. Recombinant Aβ1-42-like oligomer antigen subunit vaccine immunizes 3×Tg AD model mice to induce high levels of anti-Aβ antibodies

[0085] The present invention further evaluates the immunogenicity and immunotherapeutic effect of the recombinant Aβ1-42-like oligomer antigen subunit vaccine by 3×Tg AD model mice (for the scheme, see figure 1 Middle D). The specific scheme is as follows. The AD model mice are 3×Tg AD model mice, which are knocked in the presenilin protein PS1 M146V Genetic mice containing Tau were microinjected P301L and APP Swe Constructed a pathological model mouse of AD capable of expressing these three proteins. The disease course of this model mouse will show a certain degree of progression with the growth of the age of the mouse, and it will occur at the age of 6 months. Intracellular Aβ deposition, the pathological characteristics of synaptosomal Tau can be observed at the age of 9 months, compared with other single transgenic mice, i...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses a conformation-specific recombinant Aβ1-42-like oligomer antigen, its preparation method and application. The present invention provides a recombinant Aβ1-42-like oligomer antigen, which is a series of 6 or 12 "beta-amyloid peptide B-cell epitope Aβ1-15 and two helper T-cell epitope Th chimeric molecules". The recombinant 6 / 12×(Aβ1‑15‑Th) chimeric antigen immune serum antibody of the present invention can specifically bind to Aβ oligomers, and neutralize its toxicity, and low doses and few times of immunization of normal and model mice can produce high levels of Th2 type anti-Aβ antibody, and no harmful T cell immune response against Aβ1-42, and reduce the content of Aβ and oligomers in the brain of AD mice, up-regulate the level of related synaptic proteins, and improve the learning and memory ability. Therefore, the recombinant Aβ1-42-like oligomer antigen targeting the structural characteristics of Aβ oligomer prepared by the present invention has great potential and application prospect in the prevention of AD.

Description

technical field [0001] The invention relates to the technical fields of biopharmaceuticals and genetic engineering, in particular to a conformation-specific recombinant Aβ1-42-like oligomer antigen, a preparation method and application thereof. Background technique [0002] Alzheimer's disease (Alzheimer's disease, AD), also known as senile dementia, was first discovered by German doctor Alzheimer Alois in 1906. It is a chronic long-term neurodegenerative disease of the elderly. Cognitive and memory impairment due to deletion. According to statistics, the incidence rate of dementia in the elderly aged 60 to 80 is about 4%, while the incidence rate of elderly aged over 80 is as high as 20% to 40%. It is the most common disease among all dementias. According to the latest report of the World Health Organization, there are more than 50 million dementia patients worldwide, and it is expected that this number will triple by 2050. More than 150 million, nearly 10 million new cas...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): C07K14/47C12N15/12A61K39/00A61P25/28
CPCA61K39/0007A61P25/28C07K14/4711
Inventor 余云舟杨志新陆健昇王荣
Owner ACADEMY OF MILITARY MEDICAL SCI
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More