Conformation-specific recombinant A beta 1-42-like oligomer antigen as well as preparation method and application thereof
An oligomer and antigen technology, applied in the fields of biopharmaceuticals and genetic engineering, can solve the problems of inability to improve cognitive ability, inability to effectively neutralize oligomers, and failure to achieve the therapeutic effect of improving cognitive ability.
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0066] Example 1. Construction of recombinant prokaryotic expression vector and expression and purification of recombinant Aβ1-42-like oligomer antigen in Escherichia coli
[0067] 1. Design and synthesis of 6×(Aβ1-15-Th) and 12×(Aβ1-15-Th) genes
[0068] According to the codon degeneracy, six copies of the tandem 6×(Aβ1-15-Th) gene (see SEQID No.1) and 12 copies of the tandem 12×(Aβ1-15-Th) gene (see SEQ ID No.2), directly synthesized and cloned into the pMD18-T(TaKaRa)T vector, named pMD18-6×(Aβ1-15-Th) and pMD18-12×(Aβ1-15-Th), respectively encoding 6×(Aβ1-15-Th) and 12×(Aβ1-15-Th) (see SEQ ID No.3 and SEQ ID No.4 for the amino acid sequence), each Aβ1-15-Th is connected with a GS flexible peptide ( figure 1 Middle A). In each Aβ1-15-Th molecule, Aβ1-15 is the B-cell epitope of Aβ1-42 molecule, the sequence is DAEFRHSGYEVHHQ; Th (DAEFRHDSGYEVHHQAKFVAAWTLKAAAQYIKANSK FIGITE) is the helper T-cell epitope, including the universal DR helper T-cell epitope PADRE sequence (AKA...
Embodiment 2
[0079] Example 2. Recombinant Aβ1-42-like oligomer antigen induces normal mice to produce a high level of Th2 anti-Aβ antibody response
[0080] Using the recombinant Aβ1-42-like oligomer antigen protein 6×(Aβ1-15-Th) and 12×(Aβ1-15-Th) expressed and purified in Example 1 as the immunogen, ie subunit vaccine, to immunize mice, to test its immunogenicity. The specific method is as follows: C57 / BL6 mice (8 weeks old, female, SPF level, Experimental Animal Center of Military Medical Research Institute) were randomly divided into 3 groups, 8 mice in each group, and 5 μg of recombinant protein was immunized, while the control group (Control) Immunize with PBS without recombinant protein, and immunize four times in total. Before immunization, the antigen was diluted to a final concentration of 10% (V / V) aluminum adjuvant (Alhydrogel TM , Brenntag Biosector, Frederikssund, Denmark). Intramuscular injection of 100 μl per mouse was used for immunization. For booster immunization, th...
Embodiment 3
[0084] Example 3. Recombinant Aβ1-42-like oligomer antigen subunit vaccine immunizes 3×Tg AD model mice to induce high levels of anti-Aβ antibodies
[0085] The present invention further evaluates the immunogenicity and immunotherapeutic effect of the recombinant Aβ1-42-like oligomer antigen subunit vaccine by 3×Tg AD model mice (for the scheme, see figure 1 Middle D). The specific scheme is as follows. The AD model mice are 3×Tg AD model mice, which are knocked in the presenilin protein PS1 M146V Genetic mice containing Tau were microinjected P301L and APP Swe Constructed a pathological model mouse of AD capable of expressing these three proteins. The disease course of this model mouse will show a certain degree of progression with the growth of the age of the mouse, and it will occur at the age of 6 months. Intracellular Aβ deposition, the pathological characteristics of synaptosomal Tau can be observed at the age of 9 months, compared with other single transgenic mice, i...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


