Antigen for preparing listeria monocytogenes monoclonal antibody, monoclonal antibody, polyclonal antibody and method
A technology of Listeria monocytogenes and monoclonal antibodies, applied in chemical instruments and methods, bacterial peptides, specific peptides, etc., can solve problems such as patent publications that have not been found, and achieve high specificity, strong stability, and high sensitivity Effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment Construction
[0029] The embodiments of the present invention will be described in detail below. It should be noted that the embodiments are illustrative, not restrictive, and cannot limit the protection scope of the present invention.
[0030] The raw materials used in the present invention, unless otherwise specified, are conventional commercially available products; the methods used in the present invention, unless otherwise specified, are conventional methods in the art.
[0031] An antigen for preparing a monoclonal antibody against Listeria monocytogenes, the amino acid sequence of the antigen is SEQ NO.1:
[0032] IAPELYNITDEIAKFSSEKTALIWKNEHGETKTWSYHHLLEQANKFANVAKDAGIKKGDHVIVMTPRLLETYAIYMGLWKAGAIIIPASELLKAHDLEYRIHHANVKAIVSYNGMTAEFDKIESIPSVSKKIIVGDKLSGWEQYETLMEAAPTEFERVETSRDDAGIKKGTTGNPKGVVHIRIHGADHYA.
[0033] Monoclonal antibodies prepared using antigens as described above.
[0034] Polyclonal antibodies prepared using antigens as described above. .
[0035] Preferably, the poly...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More - R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com



