Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Antigen for preparing listeria monocytogenes monoclonal antibody, monoclonal antibody, polyclonal antibody and method

A technology of Listeria monocytogenes and monoclonal antibodies, applied in chemical instruments and methods, bacterial peptides, specific peptides, etc., can solve problems such as patent publications that have not been found, and achieve high specificity, strong stability, and high sensitivity Effect

Active Publication Date: 2020-02-21
TIANJIN UNIVERSITY OF SCIENCE AND TECHNOLOGY
View PDF6 Cites 6 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0006] Through the search, no patent publications related to the patent application of the present invention have been found

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Antigen for preparing listeria monocytogenes monoclonal antibody, monoclonal antibody, polyclonal antibody and method
  • Antigen for preparing listeria monocytogenes monoclonal antibody, monoclonal antibody, polyclonal antibody and method
  • Antigen for preparing listeria monocytogenes monoclonal antibody, monoclonal antibody, polyclonal antibody and method

Examples

Experimental program
Comparison scheme
Effect test

Embodiment Construction

[0029] The embodiments of the present invention will be described in detail below. It should be noted that the embodiments are illustrative, not restrictive, and cannot limit the protection scope of the present invention.

[0030] The raw materials used in the present invention, unless otherwise specified, are conventional commercially available products; the methods used in the present invention, unless otherwise specified, are conventional methods in the art.

[0031] An antigen for preparing a monoclonal antibody against Listeria monocytogenes, the amino acid sequence of the antigen is SEQ NO.1:

[0032] IAPELYNITDEIAKFSSEKTALIWKNEHGETKTWSYHHLLEQANKFANVAKDAGIKKGDHVIVMTPRLLETYAIYMGLWKAGAIIIPASELLKAHDLEYRIHHANVKAIVSYNGMTAEFDKIESIPSVSKKIIVGDKLSGWEQYETLMEAAPTEFERVETSRDDAGIKKGTTGNPKGVVHIRIHGADHYA.

[0033] Monoclonal antibodies prepared using antigens as described above.

[0034] Polyclonal antibodies prepared using antigens as described above. .

[0035] Preferably, the poly...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses an antigen for preparing a listeria monocytogenes monoclonal antibody. An amino acid sequence of the antigen is shown in SEQ NO.1. According to the antigen, a specific surfaceprotein fragment capable of representing listeria monocytogenes is obtained through screening and experimental verification, the specific surface protein fragment is used as an antigen sequence to obtain a positive cell line by cell fusion, after three rounds of subcloning, an indirect ELISA method is used to detect the positive strains and detect a cross-reaction between a secreted antibody and other food-borne pathogenic strains to obtain a specific fusion cell line, finally, a monoclonal hybridoma cell with high titer and good specificity is obtained, and the mouse monoclonal antibody is prepared and has a titer of 810000 and good specificity. The monoclonal antibody provided by the invention has higher sensitivity, good specificity and strong stability.

Description

technical field [0001] The invention belongs to the technical field of detection of Listeria monocytogenes, in particular to an antigen, a monoclonal antibody, a polyclonal antibody and a method for preparing monoclonal antibodies to Listeria monocytogenes. Background technique [0002] Listeria monocytogenes belongs to the genus Listeria, Gram-positive bacteria, facultative intracellular parasites, with blunt ends and no spores, and does not produce capsules. Aerobic and facultative anaerobic, the optimum growth temperature is 30-37°C, psychrophilic, acid-resistant, alkali-resistant, high-concentration salt-resistant, and heat-resistant. Sterilization requires heating at 60°C for 20 minutes or heating at 70°C for 5 minutes. [0003] Listeria monocytogenes is a zoonotic food-borne pathogen that can cause sepsis, meningitis, gastroenteritis, encephalomyelitis and pneumonia, etc., with a mortality rate as high as 20-30%. Newborns, pregnant women and immune People who are func...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): C07K14/195C07K16/12G01N33/569G01N33/577
CPCC07K14/195C07K16/1296C07K2317/33C07K2317/35G01N33/56911G01N33/577G01N2333/195
Inventor 杜欣军宋佳蓉张宸宁李萍杜婷王硕
Owner TIANJIN UNIVERSITY OF SCIENCE AND TECHNOLOGY
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com