Copeptin antibody preparation and detection establishing method
A peptide antigen, monoclonal antibody technology, applied in the field of peptide chemistry and immunology, can solve problems such as instability
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment Construction
[0024] In order to establish a detection method for CPP, the present invention provides a human CPP antigen epitope peptide antigen for producing CPP monoclonal antibody or polyclonal antibody, using the antibody to establish a detection method for CPP and a CPP in vitro diagnostic kit.
[0025] Specifically, the invention discloses a preparation process of a CPP antigen epitope peptide antigen, the steps are as follows:
[0026] Synthetic CPP epitope peptide (SEQ ID NO.1), the amino acid sequence is 126-164:
[0027] CASDRSNATQLDGPAGALLLLRLVQLAGAPEPFEPAQPDAY
[0028] Synthesized CPP-N epitope peptide (SEQ ID NO.2), the amino acid sequence is 131-140:
[0029] CKIEISNATQLDGPA
[0030] Synthesized CPP-M peptide (SEQ ID NO.3), the amino acid sequence is 131-140:
[0031] FHYKSNATQLDGPAGALL
[0032] The N-terminal of the CPP-N antigenic epitope peptide of the present invention adds 5 additional amino acids, and the outermost end is Cys amino acid, and the N-terminal of the CP...
PUM
| Property | Measurement | Unit |
|---|---|---|
| diameter | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information
Login to View More - R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com



