Preparation method of CAR-[gamma][delta]T cells
A cell and cell culture technology, applied in the field of CAR-γδT cell preparation, can solve the problems of unsatisfactory expansion and modification efficiency, and few reports on the preparation and culture of γδT cells
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
preparation example Construction
[0040] The present invention relates to a preparation method of CAR-γδT cells, which comprises:
[0041] 1) Cultivate PBMC in the culture medium for 2-4 days, and define the 0th day of initial culture as D0;
[0042] 2) transfer the cells to a culture container coated with RetroNectin and loaded with lentiviruses for expressing chimeric antigen receptor nucleic acid and culture the cells for 8h to 24h;
[0043] 3) Repeat step 2);
[0044] 4) Change the medium and inoculate into a new culture container to cultivate cells;
[0045] 5) Separating and purifying γδT cells from D7 to D9 to continue culturing;
[0046] 6) Harvest the γδT cells from D10 to D24.
[0047] In the present invention, by selecting a specific time point to transduce the CAR gene, the proportion of γδT cells is increased and the number of cells is small, so that the CAR can be modified as much as possible into the γδT cells; while the selection of the time point for separating and purifying γδT cells is in...
Embodiment 1
[0083] Example 1: Chimeric Antigen Receptor Design
[0084] In this example, the single-chain antibody (scFv) of the anti-CD19 antibody FMC63 was used as the antigen-binding domain, combined with the CD8α signal peptide, CD8α hinge region and transmembrane region, DAP10 co-stimulatory domain and CD3ζ signal transduction domain to construct a CD19-targeting Second-generation CARs.
[0085] FMC63-DAP10-CD3Z (468aa)
[0086] / / MALPVTALLLPLALLLHAARPDIQMTQTTSSLSASLGDRVTISCRASQDISKYLNWYQQKPDGTVKLLIYHTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPYTFGGGTKLEITGGGGSGGGGSGGGGSEVKLQESGPGLVAPSQSLSVTCTVSGVSLPDYGVSWIRQPPRKGLEWLGVIWGSETTYYNSALKSRLTIIKDNSKSQVFLKMNSLQTDDTAIYYCAKHYYYGGSYAMDYWGQGTSVTVSSTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCLCARPRRSPAQEDGKVYINMPGRGRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR / /
Embodiment 2
[0087] Example 2: Lentiviral Packaging
[0088] 2.1 Plasmid transfection: Put the plasmid, PEI, and Opti-MEM medium at room temperature for 5 minutes; take 36 μl of Opti-MEM4 in a 1.5ml EP tube, then add 64 μl of PEI to mix, and let stand at room temperature for 5 minutes; according to 6:9:9: 16 Add pLP1, pLP2, pLP-BaEVTR, expression plasmids, and add Opti-MEM to 500 μl, and let stand at room temperature for 5 minutes; add the prepared PEI-Opti-MEM solution to Opti-MEM containing plasmids, let stand at room temperature for 20 minutes ; Slowly drop 1ml of DNA / PEI mixture into 293T, mix gently, incubate in a 37°C incubator, replace with fresh medium after 16-18h, put in 5% CO 2 , and continue to incubate in a 37°C incubator.
[0089] 2.2 Virus collection and concentration: 48 hours after plasmid transfection, collect the supernatant, centrifuge at 2820g for 20min at 4°C to remove cell debris, and filter the supernatant with a 0.45μm filter; transfer the filtered virus supernata...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 
![Preparation method of CAR-[gamma][delta]T cells](https://images-eureka.patsnap.com/patent_img/dc1e46aa-1d6e-41b8-ac8c-34d910907119/HDA0003233761180000011.png)
![Preparation method of CAR-[gamma][delta]T cells](https://images-eureka.patsnap.com/patent_img/dc1e46aa-1d6e-41b8-ac8c-34d910907119/HDA0003233761180000021.png)
![Preparation method of CAR-[gamma][delta]T cells](https://images-eureka.patsnap.com/patent_img/dc1e46aa-1d6e-41b8-ac8c-34d910907119/HDA0003233761180000022.png)