Brain tumor targeting polypeptide and derivative and application thereof
A technology of peptide derivatives and brain tumors, applied in the field of medical biology, can solve the problems of slow research progress, lack of candidate ligands, and limited selection, and achieve the effects of broad application prospects, easy synthesis and modification, and low cost
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0048] Embodiment 1: Preparation of polypeptide sequence
[0049] Synthesize the polypeptide sequence across the blood-brain barrier by artificial synthesis method,
[0050] The polypeptide sequence is as follows:
[0051] YLGASVPSPDPLEPT SEQ ID No. 1;
[0052] YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI SEQ ID No. 2;
[0053] YLYQWLGAPVPYPDPLEPR SEQ ID No. 3;
[0054] YLYQWLGAPVPYPDPLEPREVCELNPDCDELADHIGFQEAYRRFYGPV SEQ ID No. 4.
[0055] The above-mentioned polypeptides are synthesized by conventional solid-phase synthesis or liquid-phase synthesis methods. Among them, the solid-phase synthetic peptide method is used to react from the amino acid at the C-terminal to the N-terminal. After the steps of resin activation, amino acid linkage, elution protection, and detection, the amino acid linkage is completed one by one, and then precipitated and centrifuged with excess ether, and the crude peptide is purified by HPLC. Afterwards, mass spectrometry was performed, and f...
Embodiment 2
[0057] Embodiment 2: the preparation of polypeptide probe
[0058] This embodiment provides a polypeptide probe, using the polypeptide prepared in Example 1, and combining it with ICG through an organic chemical reaction.
[0059] The specific method is purchase or synthesis. In this example, the probe is prepared by linking the polypeptide with ICG by click chemistry method, and the linker is the universal DBCO. ICG with an activating functional group containing the amino group NH 2 , carboxyl COOH, activated lipid NHS, maleimide MAL, mercapto SH, azide N 3 , alkyne ALK, and then coupled with the polypeptide prepared in Example 1 to obtain the blood-brain barrier polypeptide ICG probe.
Embodiment 3
[0060] Example 3: Modeling of brain tumor mice and detection of targeting ability
[0061] Using an adult mouse, human U87 glioma was transplanted to the cerebral cortex of the mouse through a brain locator, and after 3 days, the polypeptide ICG probe prepared in Example 2 (containing SEQ ID NO.1), Scrambled peptide probe, ICG solution (2mM) and PBS were injected into each mouse in 100 microliters, and after 24 hours, detected under the small animal imager.
[0062] See the experimental results figure 1 , by comparing the results of the 4 groups, it can be known that the peptide probe group (group A) has a specific signal at the brain tumor site, while the other three groups (group S: scrambled polypeptide probe; group N: ICG solution group; PBS group) have no signal. Shows fluorescent signal in the brain. The above experimental results show that the polypeptide probe of the present invention can achieve the effect of targeting brain tumors across the blood-brain barrier.
...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More - R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com

