Detecting lipocalin

a technology of lipocalin and lipocalin, which is applied in the field of detection of lipocalin, can solve the problems of medical practitioners and inability to find them

Inactive Publication Date: 2006-06-06
KIMBERLY-CLARK WORLDWIDE INC
View PDF19 Cites 17 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Benefits of technology

[0017]The kit can further comprise a control sample. Such a control sample can be, for example, a sam

Problems solved by technology

One area of difficulty for medical practitioners involves distinguishing between bacterial and viral infections in patients that exhibit many symptoms of either type of infection (e.g. fever, flu-like symptoms, etc.).
However, quick, reliable means for assessing whether anti-bacterial drug or an anti-viral drug should be administered are not available.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Detecting lipocalin
  • Detecting lipocalin

Examples

Experimental program
Comparison scheme
Effect test

example 1

HNL Loop Regions as Antigens for Producing Antibodies

[0097]The amino acid sequence of human neutrophil gelatinase-associated lipocalin is as follows (SEQ ID NO:1).

[0098]

1QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNA41ILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWI81RTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAM121VFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLG161LPENHIVFPVPIDQCID

[0099]Lipocalin contains eight surface-accessible loops. These areas are shown as thin yellow bands in FIG. 1. Two of these loops flank the central lipocalin beta barrel. The loop areas make good epitope targets because they are solvent exposed. The sequences of the loop regions are as follows:

[0100]

1.Pro17 to Gln28:PLQQNFQDNQFQ(SEQ ID NO: 2)2.Asn39 to Tyr52:NAILREDKDPQKMY(SEQ ID NO: 3)3.Lys59 to Ser63:KEDK(SEQ ID NO: 4)4.Arg72 to Lys75:RKKK(SEQ ID NO: 5)5.Gly86 to Gly90:GCQPG(SEQ ID NO: 6)6.Gly95 to Gly102:GNIKSYPG(SEQ ID NO: 7)7.Asn114 to Gln117:NYNQ(SEQ ID NO: 8)8.Phe168 to Asp177:FPVPIDQCID(SEQ ID NO: 9)

[0101]Any peptide within ...

example 2

Antibody Generation

[0105]This Example illustrates that specific lipocalin peptides can be used to generate antibodies that are reactive with lipocalin.

Peptides

[0106]Peptides were chosen based upon the loop regions of human neutrophil lipocalin described in the X-ray crystallographic structure published by Goetz et al. Biochemistry 2000, 39, 1935–1941. Specific peptides were chosen for conjugation to KLH protein. These peptides had the following sequences:

[0107]

SEQ ID NO: 12 - YELKEDKSSEQ ID NO: 13 - LSKVPLQQNFQDNQSEQ ID NO: 14 - GNAILREDKDPQKMYSEQ ID NO:  9 - FPVPIDQCID

[0108]KLH-conjugated peptides were synthesized and purified by HPLC by SigmaGenesis. Specifically, peptides having SEQ ID NO:12, 13 and 14 were synthesized with an N-terminal cysteine residue such that the peptide could be conjugated to KLH using succinimidyl m-maleimidobenzoate (MBS) as a coupling reagent. The peptide having SEQ ID NO:9 (FPVPIDQCID) was conjugated to KLH using activated EDC (1-ethyl-3(3-dimethylamino...

example 3

Hybridoma Cell Lines that Produce Monoclonal Antibodies

[0116]This Example illustrates that monoclonal antibodies can readily be prepared that are reactive with selected lipocalin epitopes.

Methods

[0117]Methods available in the art were utilized for in vitro and in vivo manipulation of monoclonal antibodies. Briefly, hybridoma cell lines expressing monoclonal antibodies were made by fusing B-cells from an in vivo-immunized mouse spleen with mouse myeloma cells using polyethylene glycol. Hybridoma cells were plated in several 96-well plates and were kept in culture for two weeks. Cell lines were screened for monoclonal antibodies using the ELISA method described above.

Results

[0118]Supernatants (50 μL) were removed from each of 1032 wells containing hybridoma cells created from myeloma cells and B-cells from mouse #60 (immunized with KLH-SEQ ID NO:11). These supernatants were tested for monoclonal antibodies using the aforementioned ELISA test using plates coated with CGNAILREDKDPQKMY, ...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention provides antibodies reactive with distinct lipocalin epitopes that are useful for detecting inflammation and bacterial infections in mammals.

Description

FIELD OF THE INVENTION[0001]The present invention relates to the use of antibodies directed against specific regions of lipocalin for detecting infections in a mammal.BACKGROUND OF THE INVENTION[0002]Inflammation occurs as a result of tissue damage. This tissue damage can be from microbial invasion, autoimmune processes, tissue infection, allograft rejection, or such hurtful or destructive external influences as heat, cold, radiant energy, electrical or chemical stimuli, or mechanical trauma. Whatever the cause or bodily site, the inflammatory response is quite similar, consisting of a complicated set of functional and cellular adjustments, involving the microcirculation, fluid shifts, and inflammatory cells (leukocytes). When tissue damage occurs, soluble chemical substances are elaborated which initiate the inflammatory response.[0003]The inflammatory response consists of a complex series of events that may be summarized as follows. (1) A local increase in blood flow, with capilla...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): C12P21/08A61K39/395C07H21/04C07K14/00C12N5/12C07K16/18C12N15/12G01N33/569
CPCG01N33/56911C07K16/18
InventorVILLANUEVA, JULIE M.QUIRK, STEPHEN
OwnerKIMBERLY-CLARK WORLDWIDE INC