Recombinant rubella virus E1 protein and uses thereof
A rubella virus and protein technology, applied in the field of genetic engineering, can solve the problems of difficult separation and purification of antigen component E1, no research and development of commercial diagnostic kits, and difficulty in separation of antigen components, so as to meet the needs and sensitivity of clinical diagnosis. High, specific effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0033] The preparation of embodiment 1 recombinant rubella virus E1 protein
[0034] The amino acid sequence of the recombinant rubella virus E1 protein is designed according to the amino acid sequence of RV envelope glycoprotein E1 (glycoprotein E1), and the sequence is 203-295 amino acids of the amino acid sequence of RV envelope glycoprotein E1 (glycoprotein E1).
[0035] 1.1 Synthesis of recombinant DNA of rubella virus E1 protein
[0036] The amino acid sequence of RV envelope glycoprotein E1 (glycoprotein E1) is analyzed by computer, combined with the confirmed antigenic epitope, and a part of the sequence with strong antigenicity is selected.
[0037] The complete amino acid sequence of RV envelope glycoprotein E1 (glycoprotein E1) is as follows:
[0038] EEAFTYLCTAPGCATQAPVPVRLAGVRFESKIVDGGCFAPWDLEATGACICEIPTDVSCEGLGAWVPAAPCARIWNGTQRACTFWAVNAYSSGGYAQLASYFNPGGSYYKQYHPTACEVEPAFGHSDAACWGFPTDTVMSVFALASYVQHPHKTVRVKFHTETRTVWQLSVAGVSCNVTTEHPFCNTIMPHGDPGQLEV NQQSRWGLGSPNCHG...
Embodiment 2
[0079] Example 2 Preparation and Performance Test of the Kit for Detecting Rubella Virus IgM Antibody Infection
[0080] 2.1 Preparation of a kit for detecting rubella virus IgM antibody infection
[0081] The recombinant rubella virus E1 protein prepared in Example 01 was used as the substrate for the preparation of the enzyme-labeled antigen of the kit, and the RVIgM antibody was detected by ELISA.
[0082] The kit was developed and used as follows:
[0083] 1) The principle of the kit: this strain uses anti-human IgM (μ chain) coated microwell plate, horseradish peroxidase (HRP) labeled recombinant rubella virus E1 as tracer, TMB chromogenic system, application capture The principle of the method is to detect the anti-rubella virus IgM antibody in human serum or plasma.
[0084] 2) The main components of the kit:
[0085] a) Pre-coated plates:
[0086] b) Coating solution: 0.05mol / l, carbonate buffer system with pH9.6
[0087] c) Blocking solution: composed of 0.01mol / ...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 