Adenosine triphosphate binding site predicting method for protein
A technology for adenosine triphosphate and binding sites, which is applied in the field of high-precision prediction of protein adenosine triphosphate binding sites, can solve problems such as large gaps in prediction accuracy, achieve the effects of reducing scale, solving unbalanced phenomena, and improving prediction accuracy
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
example
[0052] On the database (K. Chen, M. J. Mizianty, and L. Kurgan, "ATPsite: sequence-based prediction of ATP-binding residues," Proteome Sci, vol. 9 Suppl 1, pp. S4, 2011.) using this method a predictor. The predictor is obtained by ensemble of 5 SVMs using Dempster-Shafer evidence theory.
[0053] Taking the prediction of the ATP binding site of protein 3CQD_A as an example, the prediction results are shown in Table 1.
[0054] The amino acid sequence of protein 3CQD_A is as follows:
[0055] >3CQD_A
[0056] MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFPAGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQLEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIGNIELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQVVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDDTQKIYAYLSR
[0057] The protein has a total of 17 ATP binding sites.
[0058] As can be seen from Table 1, using this method, 12 ATP binding sites were correctly predicted, 5...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 