Supercharge Your Innovation With Domain-Expert AI Agents!

SibaDef of blood sucking insect, as well as gene and application thereof

A Banna gnat and defense peptide technology, applied in the field of biomedicine, can solve the problem that the antibacterial active substance components have not been reported publicly, and achieve the effect of inhibiting bacterial growth

Inactive Publication Date: 2015-02-18
KUNMING MEDICAL UNIVERSITY
View PDF2 Cites 4 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

The blood-sucking insect Simulium bannaense is mainly distributed in Xishuangbanna, Yunnan Province, and the antibacterial active substances in its body have not been publicly reported

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • SibaDef of blood sucking insect, as well as gene and application thereof
  • SibaDef of blood sucking insect, as well as gene and application thereof
  • SibaDef of blood sucking insect, as well as gene and application thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment Construction

[0017] The present invention will be described in detail below with reference to the accompanying drawings.

[0018] 1. Preparation and amino acid sequence determination of the defense peptide SibaDef of Banna gnat

[0019] (1), Banna gnat salivary gland homogenate:

[0020] Under a dissecting microscope, the salivary gland tissue of Gnatula spp. was removed, 1 g of salivary gland tissue sample was accumulated, 10 ml of 0.1M pH 6.0 phosphate buffered solution (PBS) was added, and the mixture was homogenized in a 20 ml glass homogenizer. The homogenate was centrifuged at 12,000 rpm for 15 minutes at 4°C, and the supernatant was stored at -80°C.

[0021] (2) Separation and purification of Banna gnat defense peptide SibaDef:

[0022] Taking the supernatant collected above as a raw material, the defense peptide SibaDef was purified according to the following procedure, and each component of the separation and purification was tested for antibacterial activity, and the specific m...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention relates to an SibaDef of a blood sucking insect, as well as a gene and application thereof, and belongs to the field of biomedicine. The molecular weight of the polypeptide is 4795.23 dalton, the isoelectric point is 8.94, and the primary structure of the complete sequence is ATCDLLSISTPWGSVNHAACAAHCLALNRGFRGGYCSSKAVCTCRK, wherein cysteine in the third place and cysteine in the thirty-sixth place compose an intramolecular disulfide bond; cysteine in the twentieth place and cysteine in the forty-second place compose an intramolecular disulfide bond; cysteine in the twenty-fourth place and cysteine in the forty-fourth place compose an intramolecular disulfide bond. The gene used for coding the SibaDef is composed of 447 nucleotides, wherein the nucleotides positioned from the one hundred and fifteenth place to the three hundred and fifteenth place are used for coding the matured SibaDef. The SibaDef has the significant effect on growth inhibition of bacteria, and can be application in preparation of a therapeutic drug for pathogenic microorganism infection diseases.

Description

Technical field: [0001] The invention relates to a blood-sucking insect Simulium bannaense defense peptide SibaDef and its gene and application, belonging to the field of biomedicine. Background technique: [0002] Under the current situation of increasingly severe antibiotic resistance, the potential application value of polypeptide antimicrobial (antibacterial peptide) drugs has attracted the close attention of researchers from all over the world. Studies have shown that antimicrobial peptides can quickly kill various Gram-positive and negative bacteria, fungi, parasites and other pathogenic microorganisms at low concentrations, and can also kill a variety of tumor cells and inhibit the reproduction and spread of viruses. In addition, they have no teratogenic effect, no cumulative toxicity, and are not prone to drug resistance. Some preclinical data suggest that antimicrobial peptides are effective against both local and systemic infections, promising a new generation of ...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): C07K14/435C12N15/12A61K38/17A61P31/04
CPCA61K38/00C07K14/43563
Inventor 杨海龙武静木丽仙韩毅刘彤吕乐春吕靖
Owner KUNMING MEDICAL UNIVERSITY
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More