26results about How to "Has antibacterial activity" patented technology

The invention discloses antibacterial bristles as well as a preparation method and application thereof. The preparation method of the antibacterial brush hair comprises the following steps: after the brush hair is subjected to oxygen plasma treatment, adding a chitosan solution and a cyanuric chloride solution, reacting under the conditions that the pH is 6-7 and the temperature is less than or equal to 15 DEG C, soaking in a quaternary ammonium salt solution, and drying to obtain the antibacterial brush hair. The antibacterial brush hair prepared by the method has excellent antibacterial property and lasting antibacterial effect, is wide in applicability and is easy for industrial production. The invention also provides the antibacterial brush hair prepared by adopting the method and application of the antibacterial brush hair.

The invention relates to the technical field of biology, in particular to a facial cleanser with double cleaning effects and a preparation method of the facial cleanser. According to the invention, the soap base and the amino acid surfactant are compounded to form a dual cleaning system, so that the problems that the skin is dry and sensitive due to the fact that a soap-base powerful cleaning agent can damage the skin barrier after being used for a long time, and the cleaning power is insufficient when the amino acid surfactant is independently used are solved; citric acid is specifically selected as the pH regulator and can be matched with potassium cocoyl glycinate, so that the cleaning capability of the facial cleanser is further enhanced; according to the invention, glycerin, hydrolyzed sodium hyaluronate, aloe extract and other components are added at the same time, so that good moisturizing and moisturizing effects are provided for the facial cleanser; the rose extract and the aloe extract which are fermented and modified by the lactobacillus and the lactobacillus plantarum are used, so that the micro-ecological balance of the skin can be adjusted, the reproduction of harmful bacteria is inhibited, and a good microbial environment is provided for the skin.

The invention belongs to the technical field of ecological water, mainly relates to ecological water for removing fruit peculiar smell, and particularly relates to ecological water for removing fruit peculiar smell and a preparation method thereof. Neotame and glucose modified cortex phellodendri are matched with tupistra chinensis, pogostemon cablin, liquorice and clove to be decocted into a traditional Chinese medicine decoction. According to the invention, lactobacillus plantarum ATCC 8014 and bacillus subtilis ATCC 6633 are used for fermentation. The antibacterial activity of the ecological water is improved, and the bitter taste of the cortex phellodendri is effectively removed due to the synergism of the two sweetening agents, namely the neotame and the glucose. The bacillus subtilis HZ-72 antagonistic bacteria used in the invention can enhance the capability of inhibiting pathogenic bacteria. Syzygium aromaticum has antibacterial activity, pogostemon cablin has an antiviral effect, and the syzygium aromaticum and the pogostemon cablin cooperate to enhance the antibacterial The ecological water prepared by the invention can remove peculiar smell and preserve freshness, and has a great development prospect in the field of fruit preservation.

This application discloses a mild and long-lasting antibacterial tea tree oil cleaning composition, its preparation method, and its application. The composition comprises the following raw material components by mass percentage: 1.5%~3.5% tea tree oil microcapsules; 0.8%~2.5% rosemary-clove compound extract; 0.2%~0.8% protease; 10%~30% surfactant; 2%~5.5% auxiliaries; 0.2%~1% preservative; 0.2%~0.8% pH adjuster; and the balance being deionized water. This composition achieves a long-lasting antibacterial effect after washing through multiple mechanisms, including microcapsule sustained release, immediate release, and synergistic effect with plant extracts, effectively solving the technical problems of tea tree oil's volatility, easy oxidation, and short antibacterial duration.

This invention provides a plant-based gel patch and its preparation method. The plant-based gel patch is prepared by mixing and freezing the following components, including modified polyvinyl alcohol, modified chitosan, functionalized borate ester, and distilled water; the preparation method is as follows: (1) modification of chitosan; (2) synthesis of functionalized borate ester; (3) preparation of allyl dihydrocaffeic acid; (4) graft modification of polyvinyl alcohol; (5) molding of the plant-based gel patch; the plant-based gel patch prepared by this invention can be used as a dressing for skin wound healing, and has antibacterial, good adhesion and self-healing ability.

This invention discloses an axially chiral 1,4'-biquinolinone and its derivatives, and a synthetic method thereof. The method uses MBH carbonate and quinoline-2(1 H Using β-ketones as raw materials, (DHQD)₂PYR as catalyst, and DME as solvent, a centrally chiral β-substituted allyl intermediate was synthesized; then, using iron powder as a reducing agent and acetic acid as solvent, enantiomeric enriched centrally chiral γ-lactam compounds were obtained; finally, using DBN as a base and DME as solvent, enantiomeric enriched compounds were obtained. (S) -Axial chiral 1,4'-biquinolinone or its derivatives. The method of this invention has mild reaction conditions, readily available raw materials, high enantioselectivity of the product, and excellent yield. The synthesized 1,4'-biquinolinone or its derivatives can be further used to synthesize novel substituted quinolinone phosphonate compounds, and to synthesize drugs with antibacterial, antimalarial, anticancer, antitumor, or herbicidal activities, showing broad application prospects.

The application relates to the technical field of packaging materials, in particular to a high-strength flame-retardant packaging material and a preparation method thereof. According to weight parts, the packaging material comprises the following raw materials: 70-90 parts of polylactic acid, 6-12 parts of polybutylene adipate terephthalate, 4-15 parts of a flame retardant, 3-7 parts of modified montmorillonite, 3-5 parts of maleic anhydride grafted polypropylene, 0.3-0.5 parts of an antioxidant and 0.5-1 part of a lubricant. The packaging material has excellent flame-retardant performance, bacteriostatic performance, barrier performance and mechanical performance.

This invention discloses a red pigment-producing Streptomyces spectabilis ( Streptomyces spectabilis This invention discloses a method and application for pigment extraction from *Streptomyces spectinomyces* S-13. The method involves fermenting *Streptomyces spectinomyces* S-13 with the addition of a surfactant to extract the pigment. This method releases intracellular pigments into the fermentation broth, significantly increasing pigment yield and simplifying the extraction and purification process. The red pigment produced by *Streptomyces spectinomyces* S-13 exhibits excellent stability, antioxidant activity, and antibacterial effects, making it suitable for applications in the printing and dyeing industry. The pigment extraction method described in this invention offers advantages such as short production cycle, low cost, safety, and environmental friendliness, overcoming the limitations of traditional microbial pigment production processes, including high extraction difficulty, low yield, and limited applicability.

The application provides a bio-based material with antibacterial effect, which comprises a polymer represented by formula (1) or a mixture of the polymer represented by formula (1) and polyethylene glycol as an antibacterial active ingredient. The application also provides use of the bio-based material. The bio-based material with antibacterial effect provided by the application has excellent and stable antibacterial activity, has significant antibacterial effect on various bacteria and fungi, and has excellent biodegradability, biocompatibility and other performances, is a bio-based product prepared through microbial fermentation, is high in safety, and is suitable for industrial production and large-scale use.

The invention discloses an indole alkaloid compound as well as a preparation method and application thereof. Belongs to the technical field of microbial pesticides. The invention provides a molecular structure of an indole alkaloid compound, a preparation related microorganism and a preparation method of the indole alkaloid compound. According to the indole alkaloid compound provided by the invention, the structural characteristics such as a structural framework and a ring forming mode are different from those of known indole alkaloid compounds. The related indole alkaloid compound is produced by fermenting a strain Aspergillus japonicus TE-739D, and is easy to carry out large-scale fermentation production; the preparation method provided by the invention can be used for rapidly and accurately preparing the indole alkaloid compound. It is found for the first time that the indole alkaloid compound has bacteriostatic activity on drug-resistant botrytis cinerea, can significantly inhibit the growth of the drug-resistant botrytis cinerea, and can be used as a lead compound or a novel biopesticide component for inhibiting the drug-resistant botrytis cinerea.

The present invention discloses an antibacterial derivative peptide LL-37 I20M / V21R And its composition and application, belonging to the application field of peptide antibiotics, antibacterial derivative peptide LL-37 I20M / V21R , and its amino acid sequence is: LLGDFFRKSKEKIGKEFKRMRQRIKDFLRNLVPRTES. The antimicrobial peptide sustained-release microcapsules prepared by the present invention have higher stability and stronger bactericidal effect. The preparation method of the antimicrobial peptide sustained-release microcapsules is simple to operate, the encapsulation rate is as high as 87.31%, and the stability is strong. The prepared antimicrobial peptide LL-37 I20M / V21R The sustained-release microcapsule product can slowly release antimicrobial peptides to exert an antibacterial effect, and has a significant effect on the elimination of Campylobacter jejuni in the body, with a maximum reduction of 4.69lg (CFU / g). It is expected to become a new product and means of prevention and control of Campylobacter jejuni.

This invention relates to mupirocin compounds, specifically to a method for preparing mupirocin derivatives. The method includes the following steps: 1) benzyloxyheptenol reacts with triethyl orthoacetate via a Claisen rearrangement to generate trans-ethyl olefin ester; 2) the trans-ethyl olefin ester undergoes oxidation to remove debenzylic protection, producing an alcohol compound; 3) the alcohol compound undergoes halogenation to generate a key branched iodide; 4) mupirocin reacts with excess trimethyl orthoformate under acidic catalysis for alcohol protection, followed by ester hydrolysis under alkaline conditions to obtain polyol-protected mupirocin acid; 5) the polyol-protected mupirocin acid reacts with the iodide via a nucleophilic substitution reaction to generate a polyalkyl mupirocin ester; 6) the polyalkyl mupirocin ester undergoes alkaline hydrolysis, followed by acid-base adjustment and deprotection to obtain the crude product, which is then neutralized to acid and purified by slurrying with an inorganic base to obtain the target compound. This invention avoids harsh reaction conditions, has readily available raw materials, high yield, simple operation and purification, and can be used for large-scale production of high-quality target compounds.

The utility model relates to medical supplies technical field discloses a big mesh hole hernia repair patch, including a plurality of medical textile monofilament, a plurality of antibacterial fiber and a plurality of flow fiber, a plurality of medical textile monofilament and a plurality of flow fiber are respectively perpendicular to each other interlaced weaving arrangement, a plurality of antibacterial fiber is respectively arranged in the clearance of a plurality of parallelly arranged flow fiber, the side wall of a plurality of flow fiber is respectively surrounded and is opened a plurality of drainage holes. The utility model provides a plurality of medical textile monofilament, a plurality of antibacterial fiber and a plurality of flow fiber are arranged mutually, and the interval is set to 3mm, can improve the mesh size of patch, does not influence the fibrous tissue production of affected part simultaneously can reduce the rejection phenomenon, and antibacterial fiber has excellent biocompatibility, can be absorbed and metabolized by human body part, contains amino in its molecular structure, makes it have antibacterial activity, can improve the antibacterial effect of patch, prevents the situation of infection.

The present application provides a black soldier fly defensin C-13326, the nucleotide sequence of the black soldier fly defensin C-13326 is shown as SEQ ID NO.1, and the application of the black soldier fly defensin C-13326 in inhibiting multiple drug-resistant Aeromonas sobria is also provided.The black soldier fly defensin C-13326 provided by the present application can be applied to the preparation of anti-drug-resistant Aeromonas sobria products to cope with the serious harm caused by drug-resistant Aeromonas sobria.

The traditional Chinese medicine skin-moistening formula is prepared by mixing traditional Chinese medicine extract, base oil, aromatic essential oil, vitamin E, olive oil, avocado oil, glycerin, beewax, refined cocoa butter, an emulsifier and ultrapure water according to a certain sequence and proportion, the traditional Chinese medicine skin-moistening formula is assisted by a modern pharmaceutical method, the antibacterial, anti-inflammatory and anti-cracking effects of traditional Chinese medicines are highlighted, and the traditional Chinese medicine skin-moistening formula is suitable for being used in the field of skin care. The invention provides a moistening, natural and healthy traditional Chinese medicine skin moistening formula, the preparation method is simple, and the traditional Chinese medicine skin moistening formula is widely applied to cosmetics and skin care products.

The invention discloses antimicrobial peptides of Monochamus alternatus and a preparation method and application thereof. Aiming at the problem that the current antimicrobial peptide gene family of Monochamus alternatus is incomplete, the scheme of the invention proposes four antimicrobial peptides of Monochamus alternatus MaltCec, MaltDef, MaltAtt-1 and MaltAtt-2 and their corresponding antimicrobial peptide genes and corresponding exogenous expression vectors and products, and also discloses corresponding induced expression and purification methods. The scheme enriches the antimicrobial peptide gene family of Monochamus alternatus and realizes the exogenous expression of antimicrobial peptide genes MaltCec, MaltDef, MaltAtt-1 and MaltAtt-2 of Monochamus alternatus; the scheme of the invention also successfully uses Pichia pastoris to express antimicrobial peptides MaltCec, MaltDef, MaltAtt-1 and MaltAtt-2 genes of Monochamus alternatus, and proves that they have antibacterial activity. The antimicrobial peptides of Monochamus alternatus of the scheme have good antibacterial effect, are reliably and stably prepared and have positive application prospects.

The invention relates to the technical field of ink, in particular to antioxidant and anticorrosive water-based printing ink and a preparation method thereof. The antioxidant and anticorrosive water-based printing ink is prepared from the following raw materials in parts by weight: 50-80 parts of water-based acrylic resin, 40-60 parts of deionized water, 30-50 parts of pigment, 8-10 parts of an antioxidant material, 5-7 parts of an anticorrosive material, 4-6 parts of a dispersing agent and 3-5 parts of a defoaming agent. According to the water-based printing ink, when the first additive and the phosphite ester in the ink exist at the same time, the phosphite ester can decompose hydroperoxide generated in the oxidation process of the water-based printing ink and hydroperoxide generated in the free radical capturing process of the hindered phenol antioxidant at the same time, and the hydroperoxide is reduced into a relatively stable alcohol compound; the hydroperoxide is prevented from being decomposed to generate new free radicals, so that the oxidation of the ink is further inhibited, and the oxidation resistance of the water-based printing ink is effectively improved.

The present invention belongs to the technical field of biomaterials, and specifically discloses a multi-component composite hydrogel, a preparation method and an application thereof. The present invention adopts carboxymethyl yeast β-1,3-glucan, oxidized carboxymethyl cellulose and carboxymethyl chitosan to prepare a multi-component composite hydrogel, and the synergistic effect of the three is improved to improve the mechanical properties of the multi-component composite hydrogel and promote wound healing.

This invention relates to the field of functional textile technology, and discloses a method for preparing a light-triggered, sustained-release traditional Chinese medicine antibacterial and mosquito-repellent outdoor textile for outdoor environments, as well as the resulting product. The preparation method involves: providing a light-triggered, sustained-release traditional Chinese medicine antibacterial and mosquito-repellent polyamide masterbatch, which consists of a polyamide matrix, uniformly dispersed traditional Chinese medicine composite microcapsules, and hindered amine light stabilizers. The core of the microcapsules contains Artemisia argyi oil, citronellal, and eugenol. The masterbatch is blended with the polyamide matrix, spun, and woven to obtain a grey fabric. The grey fabric is then subjected to ultraviolet light activation treatment to form an initial antibacterial and mosquito-repellent active layer. Finally, the outdoor textile is obtained through finishing. This invention utilizes the photosensitivity of hindered amine light stabilizers to achieve on-demand release triggered by ultraviolet light. The resulting textile exhibits antibacterial and mosquito-repellent effects, retaining ≥80% of its function after 20 washes. It is suitable for outdoor products such as tents, outdoor clothing, and sleeping bags, and has outstanding advantages such as long-lasting effectiveness, environmental safety, and ease of use.

The invention relates to the technical field of daily chemicals, in particular to an antibacterial linen detergent which comprises a surfactant, a builder, a unique composite antibacterial system and a composite biological enzyme preparation. The composite antibacterial system is formed by compounding a double-chain quaternary ammonium salt, a guanidine polymer and a plant-source antibacterial synergist according to a specific proportion, the composite antibacterial system and a biological enzyme preparation containing protease, lipase, amylase and cellulase generate a synergistic effect, and through a mechanism of first enzymolysis cleaning and then multi-target synergistic sterilization, the composite antibacterial system can be used for preparing a multi-target antibacterial agent under the low-temperature condition of 40-60 DEG C; the efficient decontamination on the linen and the broad-spectrum and lasting killing on bacteria and fungi can be realized, and the drug resistance risk of microorganisms is obviously reduced. The product does not contain a chlorine bleaching agent, is environment-friendly and safe, has small damage to fabrics, and is particularly suitable for hygienic washing of linen in the industries of hotels, hospitals and the like.

The invention discloses a polyethylene clean film, a packaging bag and a preparation method thereof, and relates to the technical field of polyethylene packaging bags, the polyethylene clean film comprises the following components by weight: 75-90 parts of low density polyethylene, 4.5-6 parts of a bacteriostatic agent, 2.5-3.6 parts of functionalized graphene oxide, and 2-3.2 parts of modified nano zinc oxide. According to the polyethylene clean film, the packaging bag and the preparation method of the polyethylene clean film, the bacteriostatic agent and the polyethylene chain interact to form hydrogen bonds or physical entanglement, so that molecular chains are combined more tightly, the tensile strength of the packaging bag is improved, and the risk of breakage is reduced; due to the addition of the bacteriostatic agent, the flexibility and the sliding property of a molecular chain are improved, energy can be dissipated through chain segment movement when the packaging bag is subjected to external force, the impact resistance and the flexibility are improved, and the possibility of embrittlement is reduced; the bacteriostatic agent can also form a barrier layer in a polyethylene matrix or disorganize a gas diffusion channel, increase the tortuosity of the gas diffusion channel and reduce the permeability of gases such as oxygen and carbon dioxide.

This invention discloses an 8-substituted aniline-chloroquinoline compound, its preparation method, and its application. The preparation method of the 8-substituted aniline-chloroquinoline compound includes the following steps: mixing compound III, compound IV, alkali, and ethanol to obtain a reaction solution, refluxing at 70-80℃ for 5-10 hours, extracting the organic phase after the reaction is completed, drying, rotary evaporating, and purifying by column chromatography to obtain the 8-substituted aniline-chloroquinoline compound. All of these 8-substituted aniline-chloroquinoline compounds exhibit certain antibacterial activity, with an inhibition rate of over 80% against *Sclerotinia sclerotiorum* causal agent of rapeseed and an inhibition rate of over 70% against *Rhizoctonia solani* var. *rhizoma*. Specifically, compound I-15 shows an inhibition rate of 92.0% against *Sclerotinia sclerotiorum* causal agent, while compounds I-11 and I-15 show inhibition rates of 78.8% and 78.5% against *Rhizoctonia solani* var. *rhizoma*, respectively.

The application relates to the fields of agricultural biotechnology and pesticide preparation technology, and discloses a preparation method and application of 2,4-di-tert-butyl phenol nanoemulsion, which comprises the following steps: 2,4-di-tert-butyl phenol is dissolved in ethyl acetate to form an oil phase mixture; the obtained oil phase mixture is mixed with Tween 80 under magnetic stirring, stirring is performed until the mixture is fully mixed, an oil phase-emulsifier system is obtained after internal gas is removed through ultrasonic treatment, then the oil phase-emulsifier system is slowly added into 8 times the volume of deionized water under magnetic stirring at 45 DEG C, and mutual dissolution of the water phase and the oil phase is promoted through ultrasonic treatment for 40 min to obtain a pre-emulsion. The obtained pre-emulsion is emulsified through a high-pressure homogenizer, 20000 psi, and circulation is performed for 8 times to obtain the nanoemulsion. The nanoemulsion prepared by the application has a nanoscale particle size, the system presents good kinetic stability, is not prone to delamination, precipitation or Ostwald ripening, and shows high storage stability.

This invention discloses a deep-sea microbial antimicrobial peptide mining method driven by deep-sea learning and its application in rice wine, belonging to the field of deep-sea extreme environment microbial resource development and traditional brewing food preservation technology. This invention efficiently mines novel, highly active antimicrobial peptides from deep-sea cold seep extreme habitat microbial metagenomic data by constructing a multimodal deep-sea learning model. These peptides exhibit significant inhibitory activity against Gram-negative bacteria, Gram-positive bacteria, and fungi. Furthermore, in the rice wine system, the addition of 7.5 μM of this antimicrobial peptide significantly inhibited the proliferation of *Lactobacillus fructose*, with an inhibitory effect comparable to that of the Gram-positive antimicrobial peptide Magaiin II. These deep-sea microbial antimicrobial peptides are natural, safe, highly efficient, biodegradable, and do not affect the flavor of rice wine, promoting the high-value utilization of deep-sea microbial resources and the high-quality development of the rice wine industry, possessing significant industrial value and broad application prospects.

The invention belongs to the technical field of biomedicine, and discloses mucus excitation hydrogel with regeneration activity and a preparation method thereof, the mucus excitation hydrogel is composed of dihydrocaffeic acid modified boloxamide, hyaluronic acid, epigallocatechin-3-gallate and bioactive factors, and the bioactive factors are KPV tripeptide and epidermal growth factors. The PHE-EK is a flowable liquid at room temperature and is gelled within 10 seconds at the body temperature. And the strain of the PHE-EK hydrogel is 77.8%. The PHE-EK hydrogel specifically adheres to the inflammatory colon through electrostatic interaction. The PHE-EK solution provided by the invention has good temperature sensitivity. The PHE hydrogel has relatively high mechanical strength and relatively high fracture strain. The PHE hydrogel can specifically adhere to the inflammatory colon by electrostatic interaction. PHE-EK enema is a promising method for treating ulcerative colitis.

This invention relates to the field of polymer materials and discloses a modified polypropylene material and its application in HPPM double-wall corrugated pipes. The modified polypropylene material comprises: polypropylene resin, modified graphitic carbon nitride, modified multi-walled carbon nanotubes, and additives. The modified graphitic carbon nitride is prepared by grafting a hindered amine-type bromine-substituted intermediate with amino-modified graphitic carbon nitride. The hindered amine-type bromine-substituted intermediate is prepared by reacting ethyl 2-amino-4-methylthiazolium-5-carboxylate with 1,4-dibromobutane and then undergoing transesterification with 2,2,6,6-tetramethyl-4-piperidinol. The modified multi-walled carbon nanotubes are prepared by grafting acyl chloride multi-walled carbon nanotubes with a cyclotriphosphazene derivative. The cyclotriphosphazene derivative is prepared by reacting 4-imidazolium formaldehyde with p-phenylenediamine, then undergoing substitution with hexachlorocyclotriphosphazene and further addition with DOPO. The modified polypropylene material prepared by this invention possesses good mechanical properties, UV aging resistance, flame retardancy, and antibacterial properties.