73results about How to "Inhibit bacterial growth" patented technology

A method of making a packaged antimicrobial suture comprising the steps of providing a containment compartment that is substantially free of an antimicrobial agent; positioning a suture within the containment compartment, said suture comprising one or more surfaces having an antimicrobial agent disposed thereon, said antimicrobial agent being selected from the group consisting of halogenated hydroxyl ethers, acyloxydiphenyl ethers, and combinations thereof; placing the containment compartment having the suture in an outer package; and subjecting the outer package, the containment compartment and the suture to time, temperature and pressure conditions sufficient to vapor transfer an effective amount of the antimicrobial agent from the suture to the containment compartment, while retaining an effective amount of said antimicrobial agent on the suture, thereby substantially inhibiting bacterial colonization on the suture and the containment compartment.

The invention discloses a controlling method of an air condition which includes the compressor, the room heat exchanger, the room fan and the controlling device. The character is in that: the electrical heater is set on the upper side of the room heat exchanger. The controlling method includes at least the follow processes: heating, the electrical heater heats and dries the room heat exchanger; mix, the mixing wind circles in the room machine; heat rejection, discharge the hot wind out of the room machine. After the air condition refrigerating or sucking the humid, the invention uses the linkage of the electrical heater, the room fan and up-down fans. It not needs to start the compressor but can do the drying operation to make the evaporator dry and move the dirty of the fan surface to inhibit the bacterium growth in evaporator surface. So it can improve the heat exchanging effect and prolong the using life.

The invention relates to a cleaning and rust inhibiting agent and a preparation method thereof, pertaining to chemical cleaning agent field, and the cleaning and rust inhibiting agent consists of the components: 1 to 2 percent of ethylenediamine tetraacetic acid solution, 3 to 4 percent of triethanolamine solution, 0.5 to 1 percent of eynanolamine solution, 5 to 10 percent of compound borate ester solution, 5 to 10 percent of polyacrylic acid solution, 1 to 3 percent of triazine disinfectant solution, and the other is water to be added into 100 percent. The cleaning and rust inhibiting agent is prepared through a scientific processing technology by using organic acid, surfactant and disinfectant as main materials, without needing to be rinsed after cleaning, and the surfaces of cleaned parts have no white spot and are as shiny as new ones, thus reaching the rust inhibiting requirements of a workshop. The product is weak alkaline, and has advantages of wide sources, easy acquiring, small using quantity and strong cleaning ability to such processing oil as rust inhibiting oil, emulsified oil, cutting fluid, oleostearine, transformer oil, etc., which is particularly applied to the cleaning and rust inhibiting for steel and aluminum materials.

The invention relates to a reagent for processing trace whole blood and an application thereof. The reagent comprises the following components: a buffer solution, an osmotic pressure retaining agent, a protective agent, an anticoagulant and a preservative. By adopting the reagent, a trace whole blood sample can be diluted by optional times (2-1000 times) and treated to obtain dilution of serum or plasma without damaging the sample and causing erythrocyte hematolysis.

The invention discloses a corrosion inhibition bactericide for oil fields, and a preparation method thereof, wherein the corrosion inhibition bactericide comprises: 8-13 parts by weight of oleic acidhydroxyethyl imidazoline, 17-22 parts by weight of dodecyldimethylbenzyl ammonium chloride, 1-5 parts by weight of hydroxyethylidene diphosphonic acid, 1-5 parts by weight of aminotrimethylene phosphonic acid, 1-3 parts by weight of ethylene glycol, 20-31 parts by weight of polymerized organic guanidine, and the balance of water. According to the present invention, the corrosion inhibiting bactericide can retard the corrosion on the collection system and the transportation system of oil fields, and can inhibit the growth of bacteria; and when the amount of the corrosion inhibition bactericideis 50 mg / L, the corrosion inhibition rate is above 75%, the corrosion rate can be controlled at below 0.076 mm / a, and the sterilization rate is above 99%.

The invention discloses a skin-care laundry detergent for infants, which comprises a nonionic surfactant, alkyl glycoside, an aloe extract, a proteinase stabilizer, a cloth penetrant, a thickener, a cloth softener, a cloth disinfectant, an essence and the balance of water. The laundry detergent is characterized in that 0.6-1 part by weight of Chinese herbal medicine antimicrobial component composed of any one or two of cloven alcohol extract, creat alcohol extract, licorice alcohol extract and dark plum alcohol extract is also added into the laundry detergent. The laundry detergent for infants is free of any preservative, and thus, is suitable for the tender skin of the infants, thereby avoiding the injury of the laundry detergent residues. By adding the Chinese herbal medicine extract into the laundry detergent as the antimicrobial component, the laundry detergent has higher anti-inflammatory property, effectively inhibits the bacteria on the clothes from growth, is mild and nonirritant for infant skin, can leave a protective film on the clothes, and still has favorable effects after the clothes are placed for some time and then put on.

The invention belongs to the technical field of water purification, in particular discloses a pen-shaped water purifier which comprises a pen-shaped shell with a hollow cavity. Both ends of the shell are respectively provided with a water inlet and a water outlet which is provided with a sucker which is convenient for a person to suck water with the mouth, filter films / filter cotton are respectively arranged in the cavity of the shell, which corresponds to the water inlet and the water outlet, and an activated carbon layer and a far-infrared functional ceramic ball layer formed by a far-infrared functional ceramic ball copying far-infrared and wave energy are filled between the two filter films / filter cotton. The pen-shaped water purifier is filtered and sterilized at a plurality of stages, can effectively filter substances in water harmful to human bodies, such as odor, turbid matter, colon bacillus, iodine and chlorine and can fully purify the water quality. In addition, the invention has simple structure, is convenient to carry and suitable for field operation and outgoing tourism and enables tap water, and water in deep wells, rivers and lakes to be directly drunk, thereby being convenient and practical.

A medical polymer material dressing for repairing wounds is characterized in that the dressing comprises a water-based polyurethane matrix and a hydrophilic colloid part which is bonded on the matrix, and the hydrophilic colloid part is composed of 20-30 percent of sodium carboxymethyl cellulose, 13-20 percent of pectin, 14-20 percent of gelatin, 30-40 percent of polyisobutylene and 5-10 percent of polyethylene.

The invention discloses waterproof and breathable shoes and a preparation method thereof. Each shoe comprises a vamp and a sole; the vamp comprises an outer layer, a middle layer and an inner layer; the outer layer is in knit construction, the middle layer adopts a waterproof and breathable polyurethane film structure, and the inner layer is made of cotton fabrics; the preparation method is as follows: orderly nesting and stacking the outer layer, the middle layer coated with dotted glue at two surfaces and the inner layer in a mould-pressing mold, hot-pressing and shaping, cooling to obtain the vamp; banburying modified white carbon black, octadecanoic acid and accelerant, and then putting in the mixed natural rubber and bytadiene styrene rubber, banburying, placing, cooking, sulfurizingto obtain the sole; adhering the vamp and the sole, performing instant punching treatment to obtain the waterproof and breathable shoe. The waterproof and breathable shoe disclosed by the invention isexcellent in waterproof and breathable performance, the bacteria breeding on the foot can be effectively inhibited, and the foot odor can be masked; the use performance is excellent, the health carecan be performed on the sole of the foot can be in the process of wearing the shoes, and the service life is long; the preparation method is simple and feasible, and the production efficiency is high.

An ulcer-healing bowel-relaxing enema biofluid film and a preparing method thereof are disclosed. The enema biofluid film is suitable for treatment on radiation enteritis, chronic ulcerative colitis, enteritis and habitual constipation and preparatory treatment before digestive tract and intestinal tract operations and enteroscopy, and is applied for performing enema therapy on patients with diabetic nephropathy, chronic nephropathy, renal failure and uremia to expel toxins through intestinal tracts so as to assist dialysis. The biofluid film is prepared into a hypertonic or isotonic, sterile, colorless or light yellow, transparent and thick biofluid film. The biofluid film can stimulate intestinal tract shrinkage to achieve constipation-relieving and bowel-relaxing functions; the biofluid film can supplement nutrition, deeply expel toxins and has a high adsorption function, thus achieving a function of deeply expelling toxins in intestinal tracts and the blood biofluid film; the biofluid film can form a protective film on the inner wall of the intestinal tract so as to promote ulcer surface healing; and the biofluid film has a function of adjusting flora balance in the intestinal tract.

The invention discloses a weaving cloth and belongs to the cloth field. The weaving cloth comprises a main body which is cotton fabric. The external surface of the main body is coated with a nano copper oxide coating. According to the weaving cloth, the main body is the cotton fabric and the external surface of the main body is coated with the nano copper oxide coating. Because of combination of the nano copper oxide coating and the main body, the weaving cloth is moisture absorbable and air permeable and has functions of maintaining sterilization and bacterial breeding inhibition effects for a long time, eliminating peculiar smell, and self-cleaning.

The invention belongs to the technical field of agricultural microbiology, and particularly relates to a high-density fermentation technique of powdered pichia pastoris. The technique comprises the steps of seed preparation and fermentor culture. The conditions of the fermentor culture are as follows: the loaded liquid volume is 40-60% (V / V), the inoculation amount is 1-5% (V / V), the control temperature is 28-40 DEG C, the ventilatory capacity is 1-3.5 VVM, the startup rotating speed is 300 r / min, the rotating speed is increased by 100 r / min in every 4h, after being increased to 700r / min, the rotating speed is kept unchanged, and the fermentation cycle is 20-30h. In the process of fermentation, by dropwise adding a NaOH solution, the pH value of fermentation liquor is adjusted to about 6.0. After 13h of fermentation, a certain amount of glucose is added at certain interval, the fermentation is completed after 20-30h, and the effective viable count is 30.0-3.5 hundred million / mL. By adopting the fermentation technique disclosed by the invention, the biomass is significantly increased, the process is simple, the efficiency is superior to that in the prior art, and the production cost is lower.

The invention discloses an antibacterial-layer panel of an electronic product. The antibacterial-layer panel comprises a transparent substrate, wherein the transparent substrate is provided with a first surface and a second surface which is arranged opposite to the first surface, the first surface of the transparent substrate is outwardly and sequentially plated with a SiO2 bottom layer, an antireflection plated film layer and an antibacterial layer, the antireflection plated film layer is formed by sequentially and alternately laminating a plurality of high-refractive-index material layers and low-refractive-index material layers, the antibacterial layer is a composite silver material layer, and both the antireflection plated film layer and the antibacterial layer are formed through film plating in a magnetron sputtering film plating manner. The antibacterial-layer panel has the advantages that the transmittance of light of the panel can be increased, and the reflectance of light of the surface of the panel can be decreased, so that human eyes can clearly see content on a screen; meanwhile, the antibacterial layer of the surface has a relatively good antibacterial effect, so that the growth of bacteria can be effectively inhibited for a long term.

The invention belongs to an automobile part and relates to a vehicle-mounted negative oxygen ion generator. The existing activated carbon air filter has the disadvantages that germs in air in a vehicle cannot be killed; harmful gas such as dimethylbenzene and methanal cannot be removed; and the use cost is high due to regular replacement of activated carbon. A negative oxygen ion generation block (8) is arranged at the upper part of a fan blade (3) and is a cylinder; air vents (6) are uniformly distributed in the middle of the cylinder; and a preparation method of the negative oxygen ion generator (8) comprises the steps of grinding, mixing and performing extrusion forming on 4 parts by weight of tourmaline, 3 parts by weight of stone needle, 2 parts by weight of magnet, 1 part by weight of Hetian jade and 2 parts by weight of porcelain clay, roasting at 1000 DEG C for 24h, and cooling a room temperature. The generator has the advantages that air bacteria are killed in the vehicle; the air in the vehicle is purified; pm2.5 (particulate matter 2.5) is reduced; the preparation is simple; and the application is extensive.

The invention belongs to the field of polyimide film modification, and more specifically discloses a method used for improving performance of polyimide film via grafting with zwitter ions and silver. The method comprises following steps: firstly, a silver ion solution is uniformly dispersed into an amino-containing solution; polyimide film is immersed in an obtained mixed solution, a reducing agent is added into the mixed solution dropwise, and the polyimide film is taken out from the mixed solution and is washed; after washing, the polyimide film is immersed in an organic solvent 1, and then is taken out from the organic solvent for drying; after drying, the polyimide film is subjected to irradiation under ultraviolet light, is immersed into an organic solvent 2, and is fixed with filter paper and immersed in a zwitter ion solution; and at last, the polyimide film in the zwitter ion solution is subjected to irradiation under ultraviolet light, and then is taken out from the zwitter ion solution, so that the surface of the polyimide film is grafted with silver nanoparticles and the zwitter ions, and the stain resistance of the obtained polyimide film is improved. The invention also discloses the polyimide film obtained via modification. The modified polyimide film is capable of inhibiting growth of bacteria, and possesses stable and reliable stain resistance; the method is simple; and industrialized application is convenient to realize.

The invention discloses eating and feeding equipment for goat breeding. The equipment comprises an eating groove and a feeding groove, wherein the feeding groove is formed in the top of the eating groove; an opening is formed in the top of the eating groove; a feeding opening is formed in the top of the feeding groove; a spiral crushing rod is arranged in the feeding groove; one end of the spiralcrushing rod is arranged in a bearing seat on the inner wall of the feeding groove, and the other end of the spiral crushing rod is in rotary connection with a motor shaft of a mixing motor through aconnecting shaft; the mixing motor is arranged outside the feeding groove; a sliding plate is arranged at the bottom of the spiral crushing rod; an opening is formed in one side of the feeding groove;one end of the sliding plate slides through the bottom of the opening and is provided with a gear; and a plurality of discharging openings are formed in the bottom plate of the feeding groove. By dividing the eating groove into a feed feeding groove and a water drinking groove, goats can be fed and drunk; a baffle plate is arranged outside the opening of the feed feeding groove; and through sliding of the baffle plate, the opening is conveniently shielded, goats are prevented from stepping in the feed feeding groove, and the consumption of the goats is conveniently controlled.

The invention provides an air filter element with antibacterial function and its use method, which comprises an inner cylinder, an outer cylinder, a filter element cylinder body, and an antibacterial disk. The upper end of the filter element cylinder body is provided with an upper fixing ring, and the upper fixing ring There is a buckle on the top, the lower end of the filter core cylinder is provided with a lower fixing ring, the outside of the filter core cylinder is provided with the outer cylinder, the outer cylinder is provided with an outer fixing ring, and the surface of the outer cylinder is set There is a groove, and the inner cylinder is arranged inside the filter core cylinder. By setting the antibacterial tray, the used filter cylinder that needs to be antibacterial is placed on the antibacterial tray, the filter cartridge is stuck in the fixed seat groove on the antibacterial tray, the switch is turned on, and the The indicator light is on, the ultraviolet lamp is working, and the bacterium in the filter cylinder can be killed by the irradiation of the ultraviolet lamp, thereby completing the antibacterial of the air filter.

The invention belongs to the field of the cleaning and chemical supplies, in particular to a perfumed soap with sterilization and skin care functions. The perfumed soap adopts the main material of tourmaline, and is formed by stirring and remixing fatty acid sodium, aloe, mushroom extractive, Sericain (fiber amine albumen), Hurb essence (Hurb), total free alkali (calculated by NaOH), chloride content (calculated by NaOH), chelating agent, anti oxidant additive, glycerine and essence. The invention richly comprises gem-grade tourmaline, and the microorganism power discharged by the tourmaline can accelerate blood circulation, promote the metabolism of skin, and ensure fair and transparent skin on the basis of cleanness; the expansion of ending capillary tubes is stimulated, the subcutaneous tissues are infiltrated, the micro cycle is improved, the elasticity and the resistance of skin are enhanced, and the ruddy and bright skin is kept. The perfumed soap has the advantages that the quality is stable, the perfumed soap facilitates absorbing effective compositions, the health of skin is enhanced, the use is convenient, and the effect is obvious.

The invention relates to an SibaDef of a blood sucking insect, as well as a gene and application thereof, and belongs to the field of biomedicine. The molecular weight of the polypeptide is 4795.23 dalton, the isoelectric point is 8.94, and the primary structure of the complete sequence is ATCDLLSISTPWGSVNHAACAAHCLALNRGFRGGYCSSKAVCTCRK, wherein cysteine in the third place and cysteine in the thirty-sixth place compose an intramolecular disulfide bond; cysteine in the twentieth place and cysteine in the forty-second place compose an intramolecular disulfide bond; cysteine in the twenty-fourth place and cysteine in the forty-fourth place compose an intramolecular disulfide bond. The gene used for coding the SibaDef is composed of 447 nucleotides, wherein the nucleotides positioned from the one hundred and fifteenth place to the three hundred and fifteenth place are used for coding the matured SibaDef. The SibaDef has the significant effect on growth inhibition of bacteria, and can be application in preparation of a therapeutic drug for pathogenic microorganism infection diseases.

The invention provides a medicine used for treating burns, scalds and bedsore, which belongs to the technical field of drugs. The medicine used for treating burns, scalds and bedsore is mainly prepared from the following raw materials through pulverizing: in terms of weight parts, 5 to 60 parts of tetracycline antibiotic, 5 to 15 parts of charcoal, 5 to 15 parts of borneol, 5 to 15 parts of alum, 3 to 7 parts of musk and 10 to 30 parts of vitamin B2, wherein the charcoal is originated from a grape vine. The medicine used for treating burns, scalds and bedsore can effectively inhibit propagation of bacteria, has good drug effect, prevents generation of scars after curing and shows good practicality.

The invention discloses a dendrobium officinale small-molecular peptide facial mask based on a gold-nano rod composite material. The facial mask comprises a facial mask fabric and essence, and is characterized in that the essence is prepared from the following components in percentage by mass: 84.05 percent of water, 0.1 percent of Carbomer, 6.0 percent of glycerinum, 1.0 percent of dendrobium officinale small-molecular peptide, 1.0 percent of gold nano-rod, 1.0 percent of polyethylene glycol-32, 0.03 percent of xanthan gum, 0.02 percent of EDTA-2Na, 1.0 percent of glycine betaine, 4.0 percent of hyaluronic acid, 1.0 percent of beta-glucan, 1.0 percent of chondrus crispus, 0.1 percent of triethanolamine, 0.3 percent of PEG-40 hydrogenated castor oil, 0.1 percent of essence, 0.18 percent of 3-Iodopropynyl butylcarbamate and 0.12 percent of dimethylol dimethyl hydantoin. Since dendrobium officinale small-molecular peptide and nano-gold composite material are added, the facial mask can be used for repairing damaged skin, inhibiting bacterium production, keeping skin tight, removing wrinkles, nourishing, moistening and whitening skin and relieving speckles.

The invention discloses a gum base chewable tablet for treating oral inflammation. Oral cavity sore removing and anti-inflammation liquid is prepared from, by weight, 22-37 parts of radix scutellariae, 21-28 parts of pseudo-ginseng, 21-25 parts of safflower carthamus, 5-16 parts of cutch, 8-21 parts of blackberry lily, 5-15 parts of honeysuckle, 2-8 parts of indigo naturalis, 5-16 parts of subprostrate sophora, 1-5 parts of calculus bovis factitius, 0.8-3.6 parts of borneol, 2-7 parts of divaricate saposhnikovia roots, 2-7 parts of liquorice, 12-21 parts of fructus forsythiae, 2-11 parts of radix bupleuri, 2.6-5.8 parts of schizonepeta, 12-16 parts of mint, 8-11 parts of vitamin C, 5-9 parts of oryzanol, 28-38 parts of xylitol and 58-98 parts of gum. The gum base chewable tablet has the following advantages that the effect is taken quickly, the treatment time is short, the medicine acting time is long, and the medicine absorption is good.

The invention relates to the technical field of air filtration and membrane material preparation and particularly relates to an antibacterial high efficiency air filtration membrane. The air filtration membrane comprises a substrate and a composite nanofiber layer. The composite nanofiber layer covers the substrate and is completely in close contact with the substrate. The composite nanofiber layer is composed of at least three materials through weaving. The composite nanofiber layer has a bead string structure. A preparation method of the antibacterial high efficiency air filtration membranecomprises: adding graphene, a cationic polymer and an electret polymer into a volatile organic solvent, setting process parameters, and electrospinning a precursor fluid to the surface of the substrate through an electrospinning device so that the composite nanofiber layer is formed. The antibacterial high efficiency air filtration membrane has a high-efficiency filtration function an can preventsecondary hazards such as bacterial breeding.

The invention relates to dry-powder paint based on surface-modified shell powder, which belongs to the technical field of inner wall dry-powder paint. The surface modified shell powder used in the dry-powder paint is calcined and catalyzed at a high temperature, so that the surface porosity of the shell powder can be improved; and gel-form titanium dioxide, active white clay and white bamboo charcoal are selected to absorb the surface of the high-temperature calcined shell powder. By virtue of the high-temperature calcining surface absorption, the surface energy of the shell powder is high, the shell powder is easy to agglomerate in an application process, the agglomeration results in cracks of a dry film when heated, and the heat resistance and aging resistance of the material are reduced. A titanate coupling agent is used for performing the surface modification treatment on the shell powder, and the surface energy can be reduced, so that the modified shell powder can be uniformly dispersed in a system, and the heat resistance and aging resistance of a paint film can be improved. The problems of an indoor wall material such as yellowing, mildew, bubbling, discoloration, cracks, short service life, and breeding of a great amount of bacteria after being wetted can be effectively avoided, and the dry-powder paint has the characteristics that the harmful gases in the air can be absorbed, and the bacteria proliferation can be inhibited.

The invention relates to a plant polysaccharide protective washing solution taking calcium-modified sodium carboxymethylcellulose as a main component. The plant polysaccharide protective washing solution comprises the following components: 0.3%-3% by weight of calcium-modified sodium carboxymethylcellulose, and 0.01%-0.1% by weight of a pH buffer substance and physiological saline, wherein the pH value of the plant polysaccharide protective washing solution is 6.5-7.5. The plant polysaccharide protective washing solution provided by the invention has the effects of performing surgical flushing, preventing adhesion and promoting wound healing, simultaneously has a hemostatic function and is good in stability and difficult to degrade.

The invention relates to an antimicrobial and sweat-absorbing T-shirt. The T-shirt comprises a T-shirt body (1). Armpits portion, a front chest portion and a back portion of the T-shirt are provided with a piece of sweat-absorbing clothes (2), wherein the sweat-absorbing clothes (2) are installed in the inner layer of the T-shirt body (1). The sweat-absorbing clothes (2) are made of knitted fabric. The T-shirt body (1) is sewed with fabric. The fabric is coated with a fungicidal coating layer. The T-shirt has the advantages of absorbing perspiration effectively and enabling users to be comfortable in wearing by the way that the armpit portions, the front chest portion and the back portion of the T-shirt are provided with sweat-absorbing clothes. The T-shirt also has the advantage of being antimicrobial.

The invention discloses a multifunctional body-building rehabilitation device. The multifunctional body-building rehabilitation device comprises a two-layer sealed box, a bottom plate paved with a heating film and a linoleum floor, a one-way visible glass top, a primary air system achieving bottom air supply, an aromatherapy system and a controller. The primary air system achieves air supply from the bottom of a body-building cabin through vent pipes arranged in a cabin body interlayer, a volatilization pipe of the aromatherapy system is arranged in front of an air supply inlet, aroma of specially-made compound essential oil can be uniform in the body-building cabin, and the effects of achieving refreshing, relieving fatigue and making people pleasant physically and mentally are achieved; the air quality in the body-building cabin is effectively kept, and it is guaranteed that a body builder can get effective training in a healthy environment.

The invention provides a Chinese giant salamander Cathelicidin-ME2 antimicrobial peptide, a gene encoding the antimicrobial peptide and uses of the antimicrobial peptide. The antimicrobial peptide contains the amino acid sequence shown in SEQ ID NO:1. The gene encoding the antimicrobial peptide contains the base sequence encoding the amino acid sequence shown in SEQ ID NO:1. The antibacterial peptide has obvious inhibitory effect on a variety of bacteria, and the minimum inhibitory concentration (MIC) of Escherichia coli (CMCC44102), Escherichia coli (ATCC25922) and Salmonella typhimurium (CMCC50115) reached 62.5 μg / mL. The antimicrobial peptide can be used to prepare, for example, feed additives, preservatives, agricultural biological control agents, drugs for controlling microbial infections, and the like.

This invention relates to a medicament for treating burn and scald and its preparation method. The functional layer of the medicament is nonwoven material prepared from chitin fiber. the preparation method comprises extracting chitin fiber, making into nonwoven material as functional layer, preparing water absorbed layer, dissolving pure chitin fiber in pure water to obtain bond, bonding functional layer and water absorbed layer, bonding base cloth and water absorbed layer, attaching antisticking paper, and sterilizing. The invention has good therapeutic effect in treating burn and scald, inhibiting bacteria growth, preventing wound from bacteria cross infection with simple carry and application, relieving labor intensity, and low cost. Dissolving pure chitin fiber in pure water as gelatinous bond solves the problem that present cemedine is harm to wound.

The present invention relates to metallo-β-lactamase inhibitor compounds of Formula I: (I) and pharmaceutically acceptable salts thereof, wherein Z, RA, X1, X2 and RB are as defined herein. The present invention also relates to compositions which comprise a metallo-β-lactamase inhibitor compound of the invention or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier, optionally in combination with a beta lactam antibiotic and / or a beta-lactamase inhibitor. The invention further relates to methods for treating a bacterial infection comprising administering to a patient a therapeutically effective amount of a compound of the invention, in combination with a therapeutically effective amount of one or more β-lactam antibiotics and optionally in combination with one or more beta-lactamase inhibitor compounds. The compounds of the invention are useful in the methods described herein for overcoming antibiotic resistance.