Polypeptide and lactobacillus plantarum extracellular metabolite, application thereof, method for inducing lactobacillus plantarum to produce bacteriocin and identification method

An extracellular metabolite, Lactobacillus plantarum technology, applied in the field of microorganisms

Active Publication Date: 2016-12-07
BEIJING UNIV OF AGRI
View PDF4 Cites 5 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, limited by the characteristics of bacteriocin itself, these strains and the conditions of the bacteriocin produced by them are subject to more doubts in industrial applications and in food processing.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Polypeptide and lactobacillus plantarum extracellular metabolite, application thereof, method for inducing lactobacillus plantarum to produce bacteriocin and identification method
  • Polypeptide and lactobacillus plantarum extracellular metabolite, application thereof, method for inducing lactobacillus plantarum to produce bacteriocin and identification method
  • Polypeptide and lactobacillus plantarum extracellular metabolite, application thereof, method for inducing lactobacillus plantarum to produce bacteriocin and identification method

Examples

Experimental program
Comparison scheme
Effect test

preparation example Construction

[0034] Thus, in a third aspect, the present invention also provides a method for preparing an extracellular metabolite of Lactobacillus plantarum containing the above-mentioned polypeptide, the method comprising:

[0035](1) performing solid-liquid separation on the fermentation product of Lactobacillus plantarum to obtain a fermentation supernatant;

[0036] (2) adding ammonium sulfate to the fermentation supernatant to carry out salting out to obtain a precipitate, and dissolving the obtained precipitate in water;

[0037] (3) performing dialysis, ion exchange and extraction on the solution obtained in step (2) in sequence, so as to obtain the extracellular metabolites of the Lactobacillus plantarum.

[0038] According to the present invention, in step (1), the culture method of the plantarum lactobacillus can adopt the conventional lactic acid bacteria culture method in the field, for example, anaerobic culture can be carried out in MRS medium at 33-40°C, or it can be speci...

preparation example 1

[0072] This preparation example is used to illustrate the preparation method of the polypeptide of the present invention

[0073] Entrust Beijing Hengyu Vision Biotechnology Co., Ltd. to synthesize the polypeptide shown in SEQ ID NO: 1 (KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNHKC) of the present invention.

preparation example 2

[0075] This preparation example is used to illustrate the preparation method of the extracellular metabolites of Lactobacillus plantarum of the present invention

[0076] (1) According to the method in the 201410816266.3 patent application, the Lactobacillus plantarum subsp. plantarum Zhang-LL strain with the preservation number CGMCC No. 6936 was expanded for 24 hours.

[0077] (2) Take the fermentation broth at 4°C, centrifuge at 8000rpm for 30 minutes at low temperature to obtain the fermentation supernatant, place the fermentation supernatant at 4°C, and place it on a magnetic stirrer, slowly add ammonium sulfate powder while stirring, The final saturation with ammonium sulfate was 70%. After overnight precipitation in a refrigerator at 4°C, centrifuge at 8000 rpm for 30 min, and suspend the precipitate in deionized water whose volume is 1 / 10 of the volume of the fermentation supernatant. Centrifuge at 8000 rpm for 30 min at 4°C to remove residual insoluble matter.

[00...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

PUM

PropertyMeasurementUnit
concentrationaaaaaaaaaa
Login to view more

Abstract

Relating to the field of microorganism, the invention discloses a polypeptide and a lactobacillus plantarum extracellular metabolite, application thereof, a method for inducing lactobacillus plantarum to produce bacteriocin and an identification method. The invention specifically relates to a polypeptide shown as SEQ ID NO:1, a lactobacillus plantarum extracellular metabolite containing the polypeptide and a preparation method, application of the polypeptide and / or lactobacillus plantarum extracellular metabolite in inducing lactobacillus plantarum to produce bacteriocin, a method for inducing lactobacillus plantarum to produce bacteriocin and an identification method of bacteriocin-producing lactobacillus plantarum. The polypeptide and / or lactobacillus plantarum extracellular metabolite can induce lactobacillus plantarum to express bacteriocin, the expression levels of the four genes papA, papB, papC gene and papD related to bacteriocin production in a lactobacillus plantarum gene are respectively increased by 9.41, 6.75, 7.94 and 6.63 times, thus indicating that adding of the polypeptide and / or lactobacillus plantarum extracellular metabolite can induce the expression of related genes in lactobacillus plantarum.

Description

technical field [0001] The present invention relates to the field of microorganisms, in particular to a polypeptide and an extracellular metabolite of Lactobacillus plantarum, and the polypeptide and / or the extracellular metabolite of Lactobacillus plantarum are used in inducing Lactobacillus plantarum to produce bacteriocins and a method for inducing Lactobacillus plantarum to produce bacteriocins. Background technique [0002] In recent decades, with the widespread use of antibiotics, more and more conventional microorganisms in the body are organically transformed into opportunistic pathogens, causing many unnecessary diseases in people. Therefore, people urgently need a new, Natural substances become substitutes for antibacterial drugs or chemical preservatives. Bacteriocin, as a natural, no side effect, and potent antibacterial substance, has attracted widespread attention and is considered to be a potential substitute for antibacterial drugs and preservatives. At pre...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

Application Information

Patent Timeline
no application Login to view more
Patent Type & Authority Applications(China)
IPC IPC(8): C07K14/335C07K1/36C07K1/34C07K1/30C07K1/18C12P21/00C12Q1/04C12R1/25
CPCC07K14/335C12P21/00C12Q1/045
Inventor 张红星金君华谢远红介琳霞高秀芝刘慧熊利霞
Owner BEIJING UNIV OF AGRI
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Try Eureka
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap