Cell structure, non-human model animal, method for producing non-human model animal, and method for evaluating test substance

A technology of model animals and non-human animals, applied in biochemical equipment and methods, cell culture supports/coatings, animal cells, etc., can solve problems such as unsuitable cancer treatment drugs, insufficient growth of interstitial tissues, etc., to achieve The effect of effective evaluation

Active Publication Date: 2018-04-17
FUJIFILM CORP
View PDF21 Cites 1 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, especially in certain cancers such as pancreatic cancer, the stroma is abundant and fibrosis is prominent, so in the above-mentioned animal model, it can be seen that the stroma tissue does not grow sufficiently, and the state of the actual pancreatic cancer is very different from that of the actual pancreatic cancer. Results inappropriate for development of effective cancer treatments

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Cell structure, non-human model animal, method for producing non-human model animal, and method for evaluating test substance
  • Cell structure, non-human model animal, method for producing non-human model animal, and method for evaluating test substance
  • Cell structure, non-human model animal, method for producing non-human model animal, and method for evaluating test substance

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0179] [Example 1] Recombinant peptide (recombinant gelatin)

[0180] The following CBE3 (described in International Publication WO2008 / 103041 A) was prepared as a recombinant peptide (recombinant gelatin).

[0181] CBE3:

[0182] Molecular weight: 51.6kD

[0183] Structure: GAP[(GXY) 63 ] 3 G

[0184] Number of amino acids: 571

[0185] RGD sequence: 12

[0186] Imino acid content: 33%

[0187] Approximately 100% of the amino acids are GXY repeat structures. The amino acid sequence of CBE3 does not contain serine, threonine, asparagine, tyrosine and cysteine. CBE3 has an ERGD sequence.

[0188] Isoelectric point: 9.34

[0189] GRAVY value: -0.682

[0190] 1 / IOB value: 0.323

[0191] Amino acid sequence (SEQ ID NO. 1 in Sequence Listing) (same as ID No. 3 of International Publication WO2008 / 103041. However, the X at the end is corrected to "P")

[0192] gaps

[0193] (GAPGLQGAPGLQGMPGERGAAGLPGPKGERGDAGPKGADGAPGAPGLQGMPGERGAAGLPGPKGERGDAGPKGADGAPGKDGVRGLAGPIGPPGER...

Embodiment 2

[0194] [Example 2] Production of recombinant peptide porous body

[0195] [PTFE thick / cylindrical container]

[0196] A cylindrical cup-shaped container made of polytetrafluoroethylene (PTFE) with a bottom thickness of 3 mm, a diameter of 51 mm, a side thickness of 8 mm, and a height of 25 mm was prepared. In the cylindrical cup, when the curved surface is used as the side surface, the side surface is sealed with 8mm PTFE, and the bottom surface (flat plate circle) is also sealed with 3mm PTFE. On the other hand, the top is in an open shape. Therefore, the inner diameter of the cylindrical cup becomes 43 mm. Hereinafter, this container is referred to as a PTFE thick / cylindrical container.

[0197] [Aluminum alloy glass plate / cylindrical container]

[0198] A cylindrical cup-shaped container made of aluminum alloy with a thickness of 1 mm and a diameter of 47 mm was prepared. In the cylindrical cup, when the curved surface is used as the side surface, the side surface is s...

Embodiment 3

[0224] [Example 3] Production of biocompatible polymer block (pulverization and crosslinking of porous body)

[0225]The CBE3 porous bodies of condition A and condition B obtained in Example 2 were pulverized using a new power mill (OSAKA CHEMICAL Co., Ltd., new power mill PM-2005). Regarding the pulverization, the pulverization was performed for a total of 5 minutes at the maximum rotation speed 1 minute x 5 times. The obtained pulverized product was sized by a stainless steel sieve to obtain uncrosslinked block materials of 25 to 53 μm, 53 to 106 μm, and 106 to 180 μm. Then, thermal cross-linking was performed at 160°C under reduced pressure (6 cross-linking times of 8 hours, 16 hours, 24 hours, 48 ​​hours, 72 hours, and 96 hours) to obtain a biocompatible polymer block (CBE3 block).

[0226] Hereinafter, the porous body-derived block under condition A crosslinked for 48 hours is referred to as E, and the porous body-derived block under condition B crosslinked for 48 hours...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
thicknessaaaaaaaaaa
diameteraaaaaaaaaa
diameteraaaaaaaaaa
Login to View More

Abstract

The purpose of the present invention is to provide: a non-human model animal rich in interstitial tissue; a cell structure useful for production of the non-human model animal; a method for evaluatinga test substance using the non-human model animal; and a method for producing the non-human model animal. The present invention provides a cell structure comprising biocompatible polymer blocks and atleast cancer cells and mesenchymal cells. The multiple biocompatible polymer blocks are disposed in the space between the multiple cells.

Description

technical field [0001] The present invention relates to a cell structure useful in the production of non-human model animals for cancer diseases. The present invention also relates to a non-human model animal for cancer diseases and a production method thereof. The present invention also relates to a method for evaluating a test substance using the above-mentioned non-human model animal. Background technique [0002] Pancreatic cancer, which is one example of cancer, is an intractable cancer with an average survival period of 3 to 6 months. Various animal models are used in the development of drugs to treat cancers such as pancreatic cancer. For example, a tumor-bearing mouse model is used as a xenograft (Xenograft) model in which human pancreatic cancer cells are transplanted into immunodeficient mice. However, especially in certain cancers such as pancreatic cancer, the stroma is abundant and fibrosis is prominent, so in the above-mentioned animal model, it can be seen ...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityApplications(China)
IPC IPC(8): A61L27/00A61K35/13A61K35/28A61P35/00A61P37/04C12N5/077C12N5/09G01N33/15G01N33/50
CPCA61L27/00A61K35/13A61K35/28G01N33/50A01K67/0271A01K2207/12A01K2207/15A01K2207/30A01K2227/105A01K2267/0331A61P35/00A61P37/04A61P37/06A61P43/00A61K49/0008C12N5/0695C12N11/02C12N2533/54
Inventor中村健太郎美马伸治北桥宗柿沼千早
OwnerFUJIFILM CORP