Pretreatment drug for t cell infusion therapy for immune-checkpoint inhibitor-resistant tumor
A technology of immune checkpoints and inhibitors, applied in the direction of anti-tumor drugs, drug combinations, drug delivery, etc., can solve the problem of small effect and achieve the effect of enhancing anti-cancer effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 2
[0077] 1. Materials and Methods
[0078] Anti-mouse CTLA-4 antibody (clone 9D9) was produced by Mie University using a hybridoma donated by Dr. James P. Allison of MD Anderson Cancer Center. Anti-mouse GITR antibody (clone DTA-1) was produced by Mie University using a hybridoma donated by Dr. Shifumi Sakaguchi of Osaka University. As the anti-mouse PD-1 antibody (clone RMP1-14), an antibody donated by Dr. Hideo Yagida of Juntendo University was used. Fetal bovine serum (FBS) was purchased from BioWest. RPMI1640 medium (with 2-mercaptoethanol added) was purchased from the Institute of Cell Science. As the mouse colorectal cancer CT26 cell line (CRL-2638), a cell line purchased from ATCC and passaged by Mie University was used. As the mouse fibrosarcoma CMS7 cell line and the mouse fibrosarcoma CMS5a cell line, cell lines obtained from Memorial Sloan Kettering Cancer Institute and passaged by Mie University were used. The human NY-ESO-1 antigen gene was a gift from Memorial ...
Embodiment 3
[0083] 1. Materials and Methods
[0084] Cholesterol pullulan (CHP for short, trade name CHP-80T) was obtained from NOF Corporation. Incomplete Freund's adjuvant (abbreviated as IFA, model F5506) was purchased from Sigma Aldrich. Long-chain peptide antigen-loaded CHP nanogels were prepared as follows. The long-chain peptide antigen chemically synthesized by Bio-Synthesis (MEN peptide: SNPARYEFLYYYYYYQYIHSANVLYYYYYYRGPESRLL (sequence number 1) or p121 peptide: NDHIAYFLYQILRGLQYIHSANVLHRDLKPSNLLLNT (sequence number 2)) was dissolved in dimethyl sulfoxide (DMSO, Nacalai for short) at a concentration of 10 mg / mL Tesque). CHP was dissolved in phosphate-buffered saline (PBS) containing 6M urea (Nacalai Tesque) at a concentration of 10 mg / mL. 1 mL (10 mg) of the long-chain peptide antigen solution and 20 mL (200 mg) of the CHP solution were mixed, and left overnight at 4°C in the dark while stirring gently. The mixed solution was transferred to a dialysis membrane (molecular weig...
Embodiment 4
[0093] 1. Materials and Methods
[0094] Rhodamine-labeled CHP nanogels were donated by Dr. Kazushige Akiyoshi, Kyoto University. APC-Cy7-labeled anti-mouse CD45 antibody (clone 30-F11), FITC-labeled anti-mouse CD8 antibody (clone 53-6.7), PE-labeled anti-mouse CD11b antibody (clone M1 / 70), Pacific blue-labeled anti-mouse F4 / 80 antibody (clone BM8) and PE-Cy7 labeled anti-mouse CD11c antibody (clone N418) were purchased from BioLegend. PerCP-Cy5.5 labeled anti-mouse CD4 antibody (clone RM4-5) was purchased from BD Bioscience. APC-labeled anti-mouse B220 antibody (clone RA3-6B2) was purchased from eBioscience. Fetal bovine serum (FBS) was purchased from BioWest. RPMI1640 medium (supplemented with 2-mercaptoethanol) was purchased from the Institute of Cell Science. Red blood cell hemolysis solution (0.15M NH 4 Cl / 10mM KHCO 3 / 0.1mM EDTA.Na 2 pH 7.2) produced by Mie University. As the mouse fibrosarcoma CMS5a cell line, a cell line donated by Memorial Sloan Kettering Canc...
PUM
| Property | Measurement | Unit |
|---|---|---|
| particle diameter | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information
Login to View More 


