Hybridoma cell strain A4-1B1, procalcitonin monoclonal antibody generated by same, and application of procalcitonin monoclonal antibody
A technology of hybridoma cell line and calcitonin, which is applied in the field of monoclonal antibodies, can solve the problems of false positives, affect the level of clinical detection, low sensitivity of antibody detection, etc., and achieve the effect of high sensitivity
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0019] Embodiment 1: Obtaining of PCT monoclonal antibody
[0020] Preparation of anti-PCT monoclonal antibody proceeds as follows:
[0021] 1. Preparation of immunogen: The protein sequence of PCT was obtained from NCBI, and the gene sequence was synthesized after prokaryotic expression codon optimization, connected to the prokaryotic expression vector pet41a, and expressed by IPTG induction. The cells were ultrasonically crushed and centrifuged to obtain the supernatant, which was passed through a nickel affinity column and a GST column, and the purified protein was used as an immunogen to immunize mice.
[0022] 2. Immunizing mice with antigens to prepare anti-PCT monoclonal antibodies, the specific implementation method is as follows: immunize mice with the above-mentioned purified protein PCT to prepare monoclonal antibodies. The specific steps are as follows: the purified immunogen was used to immunize the mice for the first time and two booster immunizations to prepare...
Embodiment 2
[0038] Example 2: Double-antibody sandwich method to screen the optimal PCT paired antibody and compare it with imported antibodies
[0039] We resuscitated the 127 monoclonal antibody cell lines we obtained, prepared monoclonal antibodies, purified them with octanoic acid method, labeled them with HRP, screened paired antibodies with checkerboard cross method, and screened out the best paired antibodies with clinical PCT positive mixed serum as the detection antigen. antibody pair.
[0040] The specific operation is as follows: coating antibody 6A2 and labeling antibody 1B1. Compared with commercial antibody pairs 16B3 (coated) / 42 (labeled) (purchased from Hytest Ltd), GRL1-2 (purchased from Grelin), NEM1-2 (purchased from Norman): Coating antibody 100 μl / well , the coating amount was 100ng, incubated at 37°C for 2h, and washed once with PBS-T; the clinical PCT positive mixed serum was diluted and added at 100ul / well, and a blank control well was set, incubated at 37°C for 3...
Embodiment 3
[0043] Embodiment 3: Western Blot identifies the antigen recognition site of the antibody
[0044] Divide PCT into 3 segments PCT-1 / 2 / 3, the corresponding amino acid sequence is as follows:
[0045] PCT-1: APFRSALESSPADPATLSEDEARLLLAALVQDYVQMKASELEQEQEREGSSLDSPRSKR
[0046] PCT-2,CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP
[0047] PCT-3: GKKRDMSSDLERDHRPHVSMPQNAN
[0048] The hybridoma cell line 6A2 secretes antibodies to recognize the PCT-1 segment antigen recognition sequence, and the hybridoma cell line 1B1 secretes antibodies to recognize the PCT-3 segment antigen recognition sequence.
[0049] Connect the PCT3 segment PCT-1 / 2 / 3 to pet41a respectively, screen out the recombinant plasmids pet41a / PCT-1, pet41a / PCT-2, pet41a / PCT-3, and transform them into BL21(DE3)gold for prokaryotic expression; 3ml The expression bacteria were resuspended in 600μl lysate (20mM PB, pH7.8-8.0), and ice-bathed for 10min; the 0.3cm probe was ultrasonically broken, and the cycle was repeated 8 times (u...
PUM
Abstract
Description
Claims
Application Information
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap