Check patentability & draft patents in minutes with Patsnap Eureka AI!

Preparation method of fluorescence immunochromatography test paper for assisting ovarian cancer diagnosis based on FSH rapid detection

A fluorescence immunochromatography and ovarian cancer technology, applied in the field of preparation of fluorescence chromatography test paper, can solve problems such as ambiguity and differences, and achieve the effects of improved detection sensitivity and specificity, fast and accurate detection, and small deviation

Pending Publication Date: 2020-05-29
JIANGSU INST OF NUCLEAR MEDICINE +1
View PDF4 Cites 1 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0003] Some studies have detected the FSH content in ovarian cancer tissue fluid by radioimmunoassay, and the results show that the FSH concentration in ovarian tumor tissue fluid has significant differences between benign and malignant, and between benign and borderline. However, it is not yet clear whether FSH-related detection products can accurately diagnose malignant tumors

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Preparation method of fluorescence immunochromatography test paper for assisting ovarian cancer diagnosis based on FSH rapid detection
  • Preparation method of fluorescence immunochromatography test paper for assisting ovarian cancer diagnosis based on FSH rapid detection
  • Preparation method of fluorescence immunochromatography test paper for assisting ovarian cancer diagnosis based on FSH rapid detection

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0025] The amino acid sequence of the analyte FSHβ subunit in the present invention is:

[0026] NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE.

[0027] The FSHβ subunit antibodies involved in the present invention include monoclonal antibodies, see Table 1 for details:

[0028] Table 1

[0029]

[0030]

[0031] Specific identification of FSH antibody: detection by ELISA, with FSH, luteinizing hormone (LH), chorionic gonadotropin (HCG), and thyroid-stimulating hormone (TSH) as detection antigens coated with ELISA plate, respectively detected by ELISA The selected FSH antibodies 1-5 react specifically with different proteins, normal BALB / c mouse serum was used as negative control, and PBS solution was used as blank control.

[0032] Specific identification results of FSH antibodies: Antibodies 1 to 5 were positive only for FSH (P / N>2.1), while luteinizing hormone (LH), chorionic gonadotropin (HCG), and t...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses a preparation method of fluorescence immunochromatography test paper for assisting ovarian cancer diagnosis based on FSH rapid detection, and the fluorescence immunochromatography test paper comprises a bottom plate, a chromatography membrane, absorbent paper, a sample pad and a fluorescent microsphere solution; the fluorescent microsphere is coupled with a labeled antibody, and the labeled antibody is an FSH beta subunit antibody 2 or an antibody 4; a detection line and a quality control line are arranged on the chromatographic membrane, and the quality control line iscoated with an antibody of homologous IgG of an anti-FSH beta subunit antibody 2 or an antibody 4; and the detection line is coated with an FSH beta subunit antibody 4 or an antibody 2. The beta subunit of FSH is preferably used as an ovarian cancer detection index, antibodies with good specificity are preferably selected from numerous antibodies and are combined, the detection sensitivity and specificity are significantly improved, the deviation is small, and rapid and accurate detection of ovarian cancer by using FSH is realized.

Description

technical field [0001] The invention belongs to the technical field of preparation methods of fluorescent chromatography test paper, and in particular relates to a preparation method of fluorescent immunochromatographic test paper based on FSH rapid detection and auxiliary ovarian cancer diagnosis. Background technique [0002] Follicle-stimulating hormone (FSH) is a hormone secreted by basophils in the anterior pituitary gland. It is an endogenous ligand of follicle-stimulating hormone receptor (FSHR), and consists of two subunits, α and β. FSH and luteinizing hormone (LH), thyroid stimulating hormone (TSH), and chorionic gonadotropin (HCG) have the same α subunit consisting of 92 amino acids; its unique β subunit consists of 111 amino acids , has the function of specifically binding to FSHR, and the 33-53 fragment has the strongest binding force to FSHR. The molecular weight of FSH is about 30Kd, and the half-life is 3-4 hours. Generally, when detecting FSH, its β subuni...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): G01N33/76G01N33/574G01N33/558G01N33/543
CPCG01N33/76G01N33/57449G01N33/558G01N33/54313
Inventor 杨润琳周彬吕中伟张珏郭明明张旭张艺范俊金浩然
Owner JIANGSU INST OF NUCLEAR MEDICINE
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More