Preparation method of fluorescence immunochromatography test paper for assisting ovarian cancer diagnosis based on FSH rapid detection
A fluorescence immunochromatography and ovarian cancer technology, applied in the field of preparation of fluorescence chromatography test paper, can solve problems such as ambiguity and differences, and achieve the effects of improved detection sensitivity and specificity, fast and accurate detection, and small deviation
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0025] The amino acid sequence of the analyte FSHβ subunit in the present invention is:
[0026] NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE.
[0027] The FSHβ subunit antibodies involved in the present invention include monoclonal antibodies, see Table 1 for details:
[0028] Table 1
[0029]
[0030]
[0031] Specific identification of FSH antibody: detection by ELISA, with FSH, luteinizing hormone (LH), chorionic gonadotropin (HCG), and thyroid-stimulating hormone (TSH) as detection antigens coated with ELISA plate, respectively detected by ELISA The selected FSH antibodies 1-5 react specifically with different proteins, normal BALB / c mouse serum was used as negative control, and PBS solution was used as blank control.
[0032] Specific identification results of FSH antibodies: Antibodies 1 to 5 were positive only for FSH (P / N>2.1), while luteinizing hormone (LH), chorionic gonadotropin (HCG), and t...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


