Supercharge Your Innovation With Domain-Expert AI Agents!

Novel method for enriching and detecting biomedicine and environmental specimens by magnetic particles

A biomedical and magnetic particle technology, applied in the field of medicine, can solve the problems of lack of medical resources, aggravation, difficulty in accurate sampling, etc., and achieve good enrichment effect

Pending Publication Date: 2020-06-19
BEIJING GUO KE RONG ZHI BIOTECH CO LTD
View PDF4 Cites 2 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0003] ①The concealment of infected people is strong: Many infected people have no obvious symptoms in the early stage, but they are still highly contagious. After they enter populated areas, they often cause large-scale infections. How to detect and diagnose such patients , so far there is no effective method;
[0004] ②Hospitals have become the source of infection: Symptomatic but undiagnosed patients lack protective measures when seeking medical treatment, resulting in a large number of pathogens spreading;
[0005] ③ Lack of medical workers: due to the sudden outbreak of the plague, the rapid spread of the epidemic, and the sharp increase in patients, the number of medical workers is seriously insufficient; at the same time, during the diagnosis and treatment process, a large number of medical workers were infected, which exacerbated this situation;
[0006] ④ Lack of medical resources: due to the surge in the number of patients, the original wards, medical equipment, protective equipment and other resources are seriously insufficient;
[0007] ⑤ Slow speed of diagnosis: For the newly discovered virus, since there is no corresponding antibody, only nucleic acid detection can be carried out, but the sensitivity of nucleic acid detection is low, and the false negative rate is high. Some patients are not even confirmed as positive until the sixth test , greatly delaying the time of diagnosis;
[0008] ⑥The sampling site has not been determined: the distribution of the new virus in the patient's body has not been fully grasped, so it is difficult to achieve accurate sampling, and the accuracy of the sampling site is directly related to the reliability of the test results. Although it is known that the new coronavirus is concentrated in Lungs, but the operation of alveolar lavage fluid is complicated, requires special equipment, and it is difficult to perform high-throughput testing; while methods such as throat swabs are simple and fast, but the amount of virus collected is small, and there is still a high false negative rate

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Novel method for enriching and detecting biomedicine and environmental specimens by magnetic particles
  • Novel method for enriching and detecting biomedicine and environmental specimens by magnetic particles
  • Novel method for enriching and detecting biomedicine and environmental specimens by magnetic particles

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0046] This embodiment provides a new method for magnetic particle enrichment detection of biomedical and environmental specimens, the method comprising the following steps:

[0047] Prepare immunomagnetic beads: use a coupling method to couple magnetosomes with SPA to prepare immunomagnetic beads;

[0048] Linking immunomagnetic beads and COVID-19 antibody (purchased from Beijing Yiqiao Shenzhou Biotechnology Co., Ltd.): combine the Bdomain of SPA with the FC end of the non-variable region of the antibody to prepare antibody-bound immunomagnetic beads;

[0049] Enrichment: Mix biomedical and environmental samples with magnetic beads linked to corresponding antibodies to enrich the antigens corresponding to the antibodies;

[0050] Wherein, SPA is SPA recombinant protein,

[0051] The sequence of the SPA recombinant protein is as follows:

[0052] GGATCC CGSGSGSADNKFNKEQQNAFYEILHLPNLTEEQRNAAIQSLKDDPSQSANLLAEAKKLNDAQAPKGSGSGSADNKFNKEQQNAFYEILHLPNLTEEQRNAAIQSLKDDPSQSANLLAEAKKL...

Embodiment 2

[0078] This embodiment provides a new method for magnetic particle enrichment detection of biomedical and environmental specimens, the method comprising the following steps:

[0079] Prepare immunomagnetic beads: use a coupling method to couple magnetosomes with SPA to prepare immunomagnetic beads;

[0080] Connect immunomagnetic beads and ricin antibody (purchased from Beijing Biolab Technology Co., Ltd.): combine the Bdomain of SPA with the FC end of the non-variable region of the antibody to prepare antibody-bound immunomagnetic beads;

[0081] Enrichment: Mix biomedical and environmental samples with magnetic beads linked to corresponding antibodies to enrich the antigens corresponding to the antibodies;

[0082] Wherein, SPA is SPA recombinant protein,

[0083] The sequence of the SPA recombinant protein is as follows:

[0084] GGATCC CGSGSGSADNKFNKEQQNAFYEILHLPNLTEEQRNAAIQSLKDDPSQSANLLAEAKKLNDAQAPKGSGSGSADNKFNKEQQNAFYEILHLPNLTEEQRNAAIQSLKDDPSQSANLLAEAKKLNDAQAPKAAGCTT; ...

Embodiment 3

[0109] This embodiment provides a new method for magnetic particle enrichment detection of biomedical and environmental specimens, the method comprising the following steps:

[0110] Prepare immunomagnetic beads: use a coupling method to couple magnetosomes with SPA to prepare immunomagnetic beads;

[0111] Linking immunomagnetic beads and cypermethrin antibody (purchased from Shanghai Future Industrial Co., Ltd.): combine the Bdomain of SPA with the FC end of the non-variable region of the antibody to prepare antibody-bound immunomagnetic beads;

[0112] Enrichment: Mix biomedical and environmental samples with magnetic beads linked to corresponding antibodies to enrich the antigens corresponding to the antibodies;

[0113] Wherein, SPA is SPA recombinant protein,

[0114] The sequence of the SPA recombinant protein is as follows:

[0115] GGATCC CGSGSGSADNKFNKEQQNAFYEILHLPNLTEEQRNAAIQSLKDDPSQSANLLAEAKKLNDAQAPKGSGSGSADNKFNKEQQNAFYEILHLPNLTEEQRNAAIQSLKDDPSQSANLLAEAKKLNDAQAPK...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
Concentrationaaaaaaaaaa
Concentrationaaaaaaaaaa
Login to View More

Abstract

The invention provides a novel method for enriching and detecting biomedical and environmental specimens by using magnetic particles. The method mainly comprises the following steps: preparing immunomagnetic beads; to be specific, coupling magnetosome with SPA by using a coupling method to prepare immunomagnetic beads; connecting the immunomagnetic beads with corresponding antibodies; to be specific, combining the Bdomain of the SPA with FC ends of non-variable regions of antibodies to prepare the immunomagnetic beads combined with the antibodies; and carrying out enrichment; to be specific, mixing biomedical and environmental specimens with the magnetic beads connected with corresponding antibodies, and enriching antigens corresponding to the antibodies. The method provided by the invention has a good enrichment effect on antigens in biomedical and environmental specimens, and is superior to synthetic magnetic beads.

Description

technical field [0001] The invention belongs to the technical field of medicine, and in particular relates to a new method for magnetic particle enrichment detection of biomedical and environmental specimens. Background technique [0002] With the increase in population and density, the risk of large-scale outbreaks of epidemic infectious diseases (plague) is increasing. In recent years, the outbreak of SARS, bird flu, and new coronary pneumonia in my country have all reflected this severe trend. Airborne transmission is The most important route of transmission of epidemic diseases, early, rapid, accurate, simple, low-cost, high-throughput diagnosis of infected persons is the key to controlling the outbreak of the plague. However, it is not easy to achieve this. In 2019 In the COVID-19 pandemic, we can see the following problems: [0003] ①The concealment of infected people is strong: Many infected people have no obvious symptoms in the early stage, but they are still highly ...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): G01N33/543C07K14/31C12N15/70
CPCG01N33/54326C07K14/31C12N15/70
Inventor 张金菊
Owner BEIJING GUO KE RONG ZHI BIOTECH CO LTD
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More