Novel method for enriching and detecting biomedicine and environmental specimens by magnetic particles
A biomedical and magnetic particle technology, applied in the field of medicine, can solve the problems of lack of medical resources, aggravation, difficulty in accurate sampling, etc., and achieve good enrichment effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0046] This embodiment provides a new method for magnetic particle enrichment detection of biomedical and environmental specimens, the method comprising the following steps:
[0047] Prepare immunomagnetic beads: use a coupling method to couple magnetosomes with SPA to prepare immunomagnetic beads;
[0048] Linking immunomagnetic beads and COVID-19 antibody (purchased from Beijing Yiqiao Shenzhou Biotechnology Co., Ltd.): combine the Bdomain of SPA with the FC end of the non-variable region of the antibody to prepare antibody-bound immunomagnetic beads;
[0049] Enrichment: Mix biomedical and environmental samples with magnetic beads linked to corresponding antibodies to enrich the antigens corresponding to the antibodies;
[0050] Wherein, SPA is SPA recombinant protein,
[0051] The sequence of the SPA recombinant protein is as follows:
[0052] GGATCC CGSGSGSADNKFNKEQQNAFYEILHLPNLTEEQRNAAIQSLKDDPSQSANLLAEAKKLNDAQAPKGSGSGSADNKFNKEQQNAFYEILHLPNLTEEQRNAAIQSLKDDPSQSANLLAEAKKL...
Embodiment 2
[0078] This embodiment provides a new method for magnetic particle enrichment detection of biomedical and environmental specimens, the method comprising the following steps:
[0079] Prepare immunomagnetic beads: use a coupling method to couple magnetosomes with SPA to prepare immunomagnetic beads;
[0080] Connect immunomagnetic beads and ricin antibody (purchased from Beijing Biolab Technology Co., Ltd.): combine the Bdomain of SPA with the FC end of the non-variable region of the antibody to prepare antibody-bound immunomagnetic beads;
[0081] Enrichment: Mix biomedical and environmental samples with magnetic beads linked to corresponding antibodies to enrich the antigens corresponding to the antibodies;
[0082] Wherein, SPA is SPA recombinant protein,
[0083] The sequence of the SPA recombinant protein is as follows:
[0084] GGATCC CGSGSGSADNKFNKEQQNAFYEILHLPNLTEEQRNAAIQSLKDDPSQSANLLAEAKKLNDAQAPKGSGSGSADNKFNKEQQNAFYEILHLPNLTEEQRNAAIQSLKDDPSQSANLLAEAKKLNDAQAPKAAGCTT; ...
Embodiment 3
[0109] This embodiment provides a new method for magnetic particle enrichment detection of biomedical and environmental specimens, the method comprising the following steps:
[0110] Prepare immunomagnetic beads: use a coupling method to couple magnetosomes with SPA to prepare immunomagnetic beads;
[0111] Linking immunomagnetic beads and cypermethrin antibody (purchased from Shanghai Future Industrial Co., Ltd.): combine the Bdomain of SPA with the FC end of the non-variable region of the antibody to prepare antibody-bound immunomagnetic beads;
[0112] Enrichment: Mix biomedical and environmental samples with magnetic beads linked to corresponding antibodies to enrich the antigens corresponding to the antibodies;
[0113] Wherein, SPA is SPA recombinant protein,
[0114] The sequence of the SPA recombinant protein is as follows:
[0115] GGATCC CGSGSGSADNKFNKEQQNAFYEILHLPNLTEEQRNAAIQSLKDDPSQSANLLAEAKKLNDAQAPKGSGSGSADNKFNKEQQNAFYEILHLPNLTEEQRNAAIQSLKDDPSQSANLLAEAKKLNDAQAPK...
PUM
Property | Measurement | Unit |
---|---|---|
Concentration | aaaaa | aaaaa |
Concentration | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information

- R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com