Treatment of tumors

a tumor and tumor technology, applied in the field of biotechnology, to achieve the effect of convenient synthesizing and us

Inactive Publication Date: 2008-06-26
BIOTEMPT
View PDF57 Cites 9 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Benefits of technology

"The patent text describes the discovery of small peptides called anti-tumor peptides that can be used to treat cancer. These peptides were previously thought to be just a byproduct of protein breakdown, but new research shows that they play an important role in the body's immune response to cancer. The invention provides methods for identifying and using these peptides in pharmaceutical compositions to reduce tumor growth and inhibit tumor progression. The peptides can be administered orally or through other mucosal routes, and they can be derived from the breakdown of hCG, a protein found in pregnant women. The patent text also describes the use of short polypeptides to modulate biological systems and treat various conditions."

Problems solved by technology

Preferably, those treatments are small molecules that are easily adsorbed by the body, cheap and easy to manufacture, effective, and do not have many of the side effect associated with current cancer treatments.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Treatment of tumors
  • Treatment of tumors
  • Treatment of tumors

Examples

Experimental program
Comparison scheme
Effect test

example i

Material and Methods

[0075]PEPTIDE SYNTHESIS: The peptides as mentioned herein such as LQG, AQG, LQGV (SEQ ID NO:1), AQGV (SEQ ID NO:2), LQGA (SEQ ID NO:37), VLPALP (SEQ ID NO:4), ALPALP (SEQ ID NO:51), VAPALP (SEQ ID NO:52), ALPALPQ (SEQ ID NO:53), VLPAAPQ (SEQ ID NO:54), VLPALAQ (SEQ ID NO:55), LAGV (SEQ ID NO:3), VLAALP (SEQ ID NO:59), VLPALA (SEQ ID NO:56), VLPALPQ (SEQ ID NO:43), VLAALPQ (SEQ ID NO:62), VLPALPA (SEQ ID NO:57), GVLPALP (SEQ ID NO:58), VVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCAL (SEQ ID NO:63), RPRCRPINATLAVEKEGCPVCITVNTTICAGYCPT (SEQ ID NO:64), SKAPPPSLPSPSRLPGPS (SEQ ID NO:65), LQGVLPALPQVVC (SEQ ID NO:66), SIRLPGCPRGVNPVVS (SEQ ID NO:67), LPGCPRGVNPVVS (SEQ ID NO:68), LPGC (SEQ ID NO:61), MTRV (SEQ ID NO:6), MTR, and VVC are prepared by solid-phase synthesis (R. B. Merrifield, J. Am. Chem. Soc., 85:2149-2165 (1963)) using the fluorenylmethoxycarbonyl (Fmoc) / tert-butyl-based methodology (Atherton, 1985) with 2-chlorotrityl chloride resin (Barlos et al., Int. J. Pepti...

example ii

[0078]Animals and tumor model: Mice (C57B16) are transplanted with the syngeneic Lewis Lung Carcinoma (LLC) subcutaneously.

[0079]Treatment modalities: mice are treated with small peptides or control substances beginning on the day of transplantation by i.p. injection. Mice are injected on Monday, Wednesday and Friday, until end of experiment. Experiment ends are based on: tumor size >20 mm, suffering of the animal, weight loss over 20%, ulcerations etc. Otherwise the experiment is terminated eight weeks after start.

Method of Efficacy Evaluation

Assessment of Tumor Response

[0080]Tumor diameter is measured in two directions by caliper measurements and tumor volume (V) is calculated using the formula V=0.4(A2XB) (where B represents the largest diameter and A the diameter perpendicular to B). The classification of tumor response is: progressive disease (PD), increase of tumor volume (>50%) within seven days (between day 3 and day 10 after begin of treatment); stable disease, tumor volume...

example iii

Method of Testing

[0092]Animals and tumor model. Mice (C57B16) are transplanted with the syngeneic Lewis Lung Carcinoma (LLC) subcutaneously. Treatment is stared 24 hours after implantation. The number of animals is eight per group to increase the power of this study. As we are starting the treatment when no tumor is palpable the change of error is larger compared to a study with established tumors. Treatment modalities: mice are treated with small peptides or sham control beginning one day after transplantation by i.p. injection. Mice will be injected on Monday, Wednesday and Friday, until end of experiment. Experiment ends based on criteria as tumor size >20 mm, suffering of the animal, weight loss over 20%, ulcerations. Otherwise the experiment will be terminated eight weeks after start.

Method of Efficacy Evaluation

Assessment of Tumor Response

[0093]Tumor diameter is measured in two directions by caliper measurements and tumor volume (V) is calculated using the formula V=0.4(A2XB) ...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
sizeaaaaaaaaaa
diameteraaaaaaaaaa
volumeaaaaaaaaaa
Login to View More

Abstract

Where it was generally thought that the smallest breakdown products of proteins had no specific biological function on their own, it now emerges that the body may utilize the normal process of proteolytic breakdown to generate important compounds such as gene-regulatory or anti-tumor compounds. Such anti-tumor compounds are useful for the treatment or prevention of tumors and can be used as part of a pharmaceutical composition. The invention provides a pharmaceutical composition for the treatment of a subject suffering from or believed to be suffering from a tumor, said pharmaceutical composition comprising: a therapeutically effective amount of anti-tumor peptide or a functional analogue or derivative thereof together with a pharmaceutically acceptable diluent.

Description

CROSS-REFERENCE TO RELATED APPLICATION[0001]This application is a divisional of co-pending U.S. patent application Ser. No. 11 / 481,423, filed Jul. 5, 2006, U.S. Patent ______, which application claims the benefit, under 35 U.S.C. § 119(e), to provisional patent application U.S. Ser. No. 60 / 696,657, filed on Jul. 5, 2005, the contents of the entirety of each of which are hereby incorporated by this reference.TECHNICAL FIELD[0002]The invention relates generally to biotechnology, and more specifically to methods of affecting tumor growth using peptides, such as tri-mers, 4-mers, 5-mers, 6-mers, 7-mers, and methods or treating subjects with a peptide and pharmaceutical compositions containing a peptide.BACKGROUND[0003]Cancer is the second leading cause of human death next to coronary disease. Worldwide, millions of people die from cancer every year. In the United States alone, as reported by the American Cancer Society, cancer causes the death of well over a half-million people annually...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityApplications(United States)
IPC IPC(8): A61K38/10A61P35/00A61K38/08A61K38/07A61K38/06
CPCA61K38/05A61K38/08A61K38/07A61K38/06A61P35/00A61P35/02A61P35/04
InventorKHAN, NISAR A.BENNER, ROBBERTWENSVOORT, GERT
OwnerBIOTEMPT