Unlock instant, AI-driven research and patent intelligence for your innovation.

Modulators of amyloid aggregation

a technology of amyloid aggregation and modulators, which is applied in the direction of drug compositions, peptide sources, peptide/protein ingredients, etc., can solve the problems of no treatment that significantly retards the progression of the disease, the societal cost of managing ad is upwards of 80 billion dollars annually, and the control and treatment of ad will become a health care problem even more significant, so as to facilitate the diagnosis of a -amyloidogenic diseas

Inactive Publication Date: 2011-01-13
PHARMA PEPTIDES
View PDF4 Cites 7 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Benefits of technology

This patent describes compounds that can prevent the formation and harmful effects of amyloid proteins in the brain associated with Alzheimer's disease. The compounds are designed to interact with the amyloid proteins and prevent them from causing damage. The compounds can be specific to certain amyloid proteins or peptides, or they can be more broadly acting. The compounds can be administered directly to the amyloid proteins or peptides, or they can be attached to other molecules or structures in the body that come into contact with the amyloid proteins. The compounds can inhibit the formation of amyloid plaques and reduce the neurotoxicity of the amyloid proteins.

Problems solved by technology

The societal cost for managing AD is upwards of 80 billion dollars annually, primarily due to the extensive custodial care required for AD patients.
Moreover, as adults born during the population boom of the 1940's and 1950's approach the age when AD becomes more prevalent, the control and treatment of AD will become an even more significant health care problem.
Currently, there is no treatment that significantly retards the progression of the disease.
Nucleation can be accelerated by the addition of a “seed” or preformed nucleus, which results in rapid polymerization.
However, equimolar amounts of the mutant and non-mutant (i.e., natural) β amyloid peptides were used to see this effect and the mutant peptides were reported to be unsuitable for use in vivo.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Modulators of amyloid aggregation
  • Modulators of amyloid aggregation
  • Modulators of amyloid aggregation

Examples

Experimental program
Comparison scheme
Effect test

example 1

Construction of β-Amyloid Modulators

[0246]A β-amyloid modulator composed of an amino-terminally biotinylated β-amyloid peptide of the amino acid sequence:

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

(positions 1 to 40 of SEQ ID NO: 1) was prepared by solid-phase peptide synthesis using an Nα-9-fluorenylmethyloxycarbonyl (FMOC)-based protection strategy as follows. Starting with 2.5 mmoles of FMOC-Val-Wang resin, sequential additions of each amino acid were performed using a four-fold excess of protected amino acids, 1-hydroxybenzotriazole (HOBt) and diisopropyl carbodiimide (DIC). Recouplings were performed when necessary as determined by ninhydrin testing of the resin after coupling. Each synthesis cycle was minimally described by a three minute deprotection (25% piperidine / N-methyl-pyrrolidone (NMP)), a 15 minute deprotection, five one minute NMP washes, a 60 minute coupling cycle, five NMP washes and a ninhydrin test. To a 700 mg portion of the fully assembled peptide-resin, biotin (o...

example 2

Inhibition of β-Amyloid Aggregation by Modulators

[0249]The ability of β-amyloid modulators to inhibit the aggregation of natural β-AP when combined with the natural β-AP was examined in a series of aggregation assays. Natural (3-AP (β-AP1-40) was obtained commercially from Bachem (Torrance, Calif.) Amino-terminally biotinylated β-AP modulators were prepared as described in Example 1.

A. Optical Density Assay

[0250]In one assay, β-AP aggregation was measured by determining the increase in turbidity of a solution of natural β-AP over time in the absence or presence of various concentrations of the modulator. Turbidity of the solution was quantitated by determining the optical density at 400 nm (A400 nm) of the solution over time.

[0251]The aggregation of natural β-AP in the absence of modulator was determined as follows. β-AP1-40 was dissolved in hexafluoro isopropanol (HFIP; Aldrich Chemical Co., Inc.) at 2 mg / ml. Aliquots of the HFIP solution (87 μl) were transferred to individual 10 m...

example 3

Neurotoxicity Analysis of β-Amyloid Modulators

[0258]The neurotoxicity of the β-amyloid modulators is tested in a cell-based assay using the neuronal precursor cell line PC-12, or primary neuronal cells, and the viability indicator 3,(4,4-dimethylthiazol-2-yl)2,5-diphenyl-tetrazolium bromide (MTT). (See Shearman, M. S. et al. (1994) Proc. Natl. Acad. Sci. USA 91:1470-1474; Hansen, M. B. et al. (1989) J. Immun. Methods 119:203-210). PC-12 is a rat adrenal pheochromocytoma cell line and is available from the American Type Culture Collection, Rockville, Md. (ATCC CRL 1721). MTT (commercially available from Sigma Chemical Co.) is a chromogenic substrate that is converted from yellow to blue in viable cells, which can be detected spectrophotometrically.

[0259]To test the neurotoxicity of a β-amyloid modulator (either alone or combined with natural β-AP), cells first are plated in 96-well plates at 7,000-10,000 cells / well and allowed to adhere by overnight culture at 37° C. Serial dilutions...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
structureaaaaaaaaaa
lengthaaaaaaaaaa
aggregationaaaaaaaaaa
Login to View More

Abstract

Compounds that modulate the aggregation of amyloidogenic proteins or peptides are disclosed. The modulators of the invention can promote amyloid aggregation or, more preferably, can inhibit natural amyloid aggregation. In a preferred embodiment, the compounds modulate the aggregation of natural β amyloid peptides (β-AP). In a preferred embodiment, the β amyloid modulator compounds of the invention are comprised of an Aβ aggregation core domain and a modifying group coupled thereto such that the compound alters the aggregation or inhibits the neurotoxicity of natural β amyloid peptides when contacted with the peptides. Furthermore, the modulators are capable of altering natural β-AP aggregation when the natural β-APs are in a molar excess amount relative to the modulators. Pharmaceutical compositions comprising the compounds of the invention, and diagnostic and treatment methods for amyloidogenic diseases using the compounds of the invention, are also disclosed.

Description

RELATED APPLICATIONS[0001]This application is a continuation of U.S. patent application Ser. No. 10 / 463,729, filed on Jun. 17, 2003, which is a continuation of U.S. patent application Ser. No. 09 / 972,475, filed on Oct. 4, 2001, which is a continuation of U.S. patent application Ser. No. 08 / 617,267, filed on Mar. 14, 1996, which is a continuation-in-part of U.S. patent application Ser. No. 08 / 404,831, filed Mar. 14, 1995, and U.S. patent application Ser. No. 08 / 475,579, filed Jun. 7, 1995 and U.S. patent application Ser. No. 08 / 548,988, filed Oct. 27, 1995, the entire contents of each of which are hereby incorporated herein by reference.BACKGROUND OF THE INVENTION[0002]Alzheimer's disease (AD), first described by the Bavarian psychiatrist Alois Alzheimer in 1907, is a progressive neurological disorder that begins with short term memory loss and proceeds to disorientation, impairment of judgement and reasoning and, ultimately, dementia. The course of the disease usually leads to death...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(United States)
IPC IPC(8): A61K38/16C07K14/00C07K7/08A61K38/10A61P43/00A61K31/00A61K39/02A61K38/00A61K51/00A61P25/00C07K7/06C07K14/47
CPCC07K14/4711A61K38/00A61P25/00A61P43/00
Inventor FINDEIS, MARK A.BENJAMIN, HOWARDGARNICK, MARC B.GEFTER, MALCOLM L.HUNDAL, ARVINDKASMAN, LAURAMUSSO, GARYSIGNER, ETHAN R.WAKEFIELD, JAMESREED, MICHAEL J.
Owner PHARMA PEPTIDES