Novel mass spectrum analysis reagent box and method for detecting heavy hepatitis B
A hepatitis B, kit technology, applied in analytical materials, biological tests, measurement devices, etc., can solve problems such as difficult chemical structures, protein sequence identification and analysis, etc.
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0070] Example 1 A novel mass spectrometry kit and method for detecting severe hepatitis B
[0071] (1) Experimental method
[0072] 1. Materials
[0073] 1. Specimen source: A. Serum from 50 cases of normal control group; B. Serum from 25 cases of severe hepatitis B patients; C. Serum from 10 critically ill patients with severe hepatitis B (within two days before the death of the patient) ; E. Serum of 10 patients with acute hepatitis B.
[0074] 2. Quality control: A. Human standardized quality control serum B. Mass spectrometer laser energy regulation: Before each test, use the above-mentioned standardized quality control serum.
[0075] 2. Method
[0076] 1. Collection of samples: After the whole blood is collected, draw the serum and store it at -80°C; take out the serum sample in the refrigerator at -80°C, and put it on the ice box to melt; centrifuge at 10,000 rpm and 4°C for 2 minutes; take the supernatant liquid.
[0077] 2. Sample preparation: 2.5 μl of serum is...
Embodiment 2
[0098] Example 2 Identification of β2-microglobulin molecules in blood
[0099] Carbodiimide method (Carbodiimide Method) will have carboxylic acid groups labeled magnetic beads matrix and anti-β2-microglobulin antibody amino groups (Gunn DL, et al.Preparation of sensitive and stable erythrocytes by the carbodiimide method for the detection of primary and secondary IgM and IgG antibody. J Immunol Methods. 1972; 1(4): 381-389.).
[0100] The sample is spotted on a site of an anti-β2-microglobulin antibody matrix.
[0101] Wash with binding buffer. Apply the first wash solution to the site before the sample is completely dry. The wash solution was left on the spot for at least 10 seconds. Thoroughly remove the first wash solution and repeat the above steps with the second wash solution. Thoroughly wash the entire array point with 1% trifluoroacetic acid, elute the biomarkers onto a special metal sheet for mass spectrometry (with 3×3mm round holes), dry the metal sheet natura...
Embodiment 3
[0107] Example 3 Severe Hepatitis B Protein Fingerprint - Sorting Identification of Characteristic Peaks
[0108] The 11729±15Da biomarkers were sorted by multiple-stage mass spectrometry (MS / MS), post-source fragmentation (PSD) and protein ladder sequencing. By breaking molecules into pieces, protein ladders can be generated. This gradient is then analyzed by mass spectrometry. Check the molecular weight of the blood β2-microglobulin molecule in the known cDNA database (molecular weight: 13705.9Da, pI: 6.1). A 11729±15 Da biomarker was identified as variant β2-microglobulin. Its chemical structure is (amino acids arranged from N-terminal to C-terminal):
[0109] Chemical structures of 11729 ± 15 Da biomarkers:
[0110] N-terminal
[0111] IQRTPKIQVYSRHPAENGKSNFLNCYVSGF
[0112] 51 HPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYAC
[0113] 101 RVNHVTLSQPKIVKWDRDM
[0114] C-terminal.
PUM
| Property | Measurement | Unit |
|---|---|---|
| molecular weight | aaaaa | aaaaa |
| molecular weight | aaaaa | aaaaa |
| molecular weight | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information
Login to View More 