Structure of coxsackie virus A16-3C protease and application thereof

A coxsackie virus and protease technology, applied in the field of 3C protease structure, can solve the problem of difficult screening of specific inhibitor molecules

Active Publication Date: 2011-09-14
INST OF MICROBIOLOGY - CHINESE ACAD OF SCI
View PDF1 Cites 3 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

Therefore, there may be a large difference between the CVA16-3C protease structure modeled on the basis of the 3C protease structure of HRV or CVB3 virus and the real structure, which also makes it difficult to screen specific inhibitor molecules for the 3C protease of CVA16 virus

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Structure of coxsackie virus A16-3C protease and application thereof
  • Structure of coxsackie virus A16-3C protease and application thereof
  • Structure of coxsackie virus A16-3C protease and application thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0032] The acquisition of embodiment 1 CVA16 3C protease

[0033] We successfully expressed the 3C protease of CVA16 virus in vitro, and obtained high-purity and active enzyme protein by affinity chromatography and molecular exclusion chromatography.

[0034] The amino acid sequence of CVA16 3C protease is shown in SEQ ID NO.1, or the sequence shown in SEQ ID NO.1 is substituted, deleted or added with one or several amino acids and has 3C protease activity derived from the amino acid sequence of SEQ ID NO.1 of protein.

[0035] Protein sequence SEQ ID NO.1:

[0036] GPSLDFALSLLRRNIRQVQTDQGHFTMLGVRDRLAILPRHSQPGKTIWVEHKLINVLDAVELVDEQGVNLELTVTLDTNEKFRDVTKFIPETITGASDA

[0037] 1. Plasmid construction:

[0038] We artificially synthesized the DNA fragment encoding 3C protease, ligated it into the pET-21a vector with Nde1 and Xho1 restriction sites, and inserted a 6-histidine tag (hexa-His-tag) behind the encoding fragment of the enzyme protein. The coding sequence is followed ...

Embodiment 2

[0050] Example 2 Structure of CVA16 3C protease

[0051] 1. Protein crystallization conditions:

[0052] We used the hang-drop vapor-diffusion method and optimized the conditions to obtain crystals with good diffraction quality.

[0053] The protein preparation solutions used for crystallization all have a protein concentration of 10 mg / ml. The conditions are as follows:

[0054] CVA16-3C crystallization conditions: 0.1M BIS-TRIS pH 5.5, 0.1M ammonium acetate and 17% w / v PEG 10000

[0055] The crystallization conditions of the complex of CVA16-3C-C147A and FAGLRQAVTQ polypeptide: 0.1 M HEPES pH7.5, 0.2M lithium sulfate and 25% w / v PEG 3350, the molar concentration ratio of protein to polypeptide is 1:5.

[0056] The crystallization conditions of the complex of CVA16-3C and AG7088: 0.1 M sodium acetate pH4.6, 0.1M magnesium chloride and 25% w / v PEG 4000, the molar concentration ratio of protein to compound is 1:3.

[0057] 2. Data collection and structure analysis:

[...

Embodiment 3

[0062] Example 3 The substrate binding groove of CVA16-3C protease

[0063] The nomenclature of each site of the 3C protease substrate binding groove: usually we use the peptide bond cleaved on the substrate polypeptide as the reference point, and the amino acids to the left are named P1, P2, P3, P4,...Pn in sequence, and the amino acids to the right are named in sequence Named P1', P2', P3', P4',...Pn'; and the part of the protease that accommodates these polypeptide amino acids is correspondingly named as the site S1, S2, S3, S4,...Sn, S1 ', S2', S3', S4',...Sn'.

[0064] Through the complex structure of the substrate polypeptide and CVA16-3C, and the complex structure of the compound AG7088 and CVA16-3C, we were able to determine the conserved substrate-binding groove in proteases ( Figure 5 ), Figure 5 The stick model in A is the substrate polypeptide, Figure 5 The stick model in B is the compound AG7088, both of which are combined in the same groove-like structure on...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses a structure of a coxsackie virus A16-3C protease and an application thereof, which belong to the field of RNA (Ribose Nucleic Acid) virus proteins. The invention also discloses an application of using a 3C protease and a substrate binding groove in drug design. The protein provided by the invention has a special substrate binding groove; a novel anti-virus CVA16 3C protease drug can be designed according to the space structure of the substrate binding groove so as to obtain a more specific inhibitor with better effect for the virus CVA16 3C protease; therefore, a potential alternative drug is provided for clinically treating hand-foot-and-mouth diseases and very high application values are obtained.

Description

technical field [0001] The invention relates to the structure and application of a 3C protease, in particular to a Coxsackievirus A16 (CVA16) 3C protease with a unique substrate binding groove. Background technique [0002] Coxsackievirus A16 (CVA16) is one of the most common pathogens causing HFMD in children. In recent years, hand, foot and mouth disease has spread worldwide, especially in East Asia (mainland China, Taiwan, Japan, etc.), resulting in huge loss of life, property and economy. At present, there is no effective means of prevention and treatment. [0003] CVA16 encodes a virus-specific protease called 3C protease. This protease can process the polyprotein precursor encoded by the virus into functional protein subunits, thus playing an important role in the replication and life cycle of the virus. Humans lack the homologous protein of this protease, so the compound that can inhibit the activity of this protease can effectively inhibit the replication of virus...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): C12N9/50G06F19/16C12R1/93
Inventor高福逯光文
OwnerINST OF MICROBIOLOGY - CHINESE ACAD OF SCI