Unlock instant, AI-driven research and patent intelligence for your innovation.

Polyethylene glycol modified insulin-like polypeptide and application thereof

A technology of polyethylene glycol and insulin, which is applied to medical preparations with non-active ingredients, medical preparations containing active ingredients, peptides, etc., can solve the problems of short half-life of polypeptides, achieve long half-life, prevent or treat diabetes, Effects of treating or preventing diabetes

Inactive Publication Date: 2015-12-23
SUZHOU PULUODA BIOLOGICAL SCI & TECH
View PDF4 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, the half-life of the above-mentioned polypeptides is short, which brings pain to patients with chronic diseases of diabetes.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Polyethylene glycol modified insulin-like polypeptide and application thereof
  • Polyethylene glycol modified insulin-like polypeptide and application thereof
  • Polyethylene glycol modified insulin-like polypeptide and application thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 2

[0014] In vivo hypoglycemic experiment of polyethylene glycol-modified insulin-mimetic polypeptide

[0015] Kunming mice were fed with high-fat and high-sugar to a body weight of 18-22 g, half male and half female, fasted for 24 hours before the experiment, and intraperitoneally injected with streptozotocin (STZ) 50 mg / kg (1% citrate buffer). liquid solution preparation). One week later, blood glucose (BS) was measured by blood collection from the tail vein of the mice. If the BS was higher than 16mmol / L, the modeling was successful. After modeling, the mice were divided into 3 groups, 10 in each group. Diabetes model group (DM group): subcutaneous injection of the same amount of PBS buffer; control group (insulin): 20 μg / kg subcutaneous injection (dissolved in 0.1mol / LPBS buffer), twice a day for 15 consecutive days; sample group (polyethylene glycol-modified insulin-mimetic polypeptide): 1 mg / kg subcutaneous injection (dissolved in 0.1mol / LPBS buffer), once a day , for 15 ...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention relates to the field of medicines, and concretely relates to a polypeptide with insulin promotion activity and capable of preventing and treating diabetes. The sequence of the polypeptide is a brand new sequence represented by PEG-GSLQKRGIVEQCCTSICSLYQLENYCN, and the molecular weight of the PEG is 1000-20000. The peptide can be used to treat the diabetes, and has potential new drug exploitation values.

Description

Technical field: [0001] The present invention relates to the field of medicine, in particular to an insulin-mimetic polypeptide for preventing and treating or preventing diabetes. Background technique: [0002] Diabetes mellitus is a group of metabolic diseases characterized by hyperglycemia. It is a syndrome of glucose, protein and lipid metabolism disorders caused by insufficient insulin or defects in insulin cell metabolism. In recent years, the number of diabetic patients has gradually increased, and is divided into type I diabetes and type II diabetes. Among them, the number of patients with type II diabetes accounts for 85-90% of the total number of diabetes, which seriously threatens the health and life of patients. If diabetes is not well controlled, it may cause many complications, such as diabetic nephropathy, retinopathy, high blood pressure, etc. [0003] At present, most patients treat diabetes by injecting insulin or oral hypoglycemic drugs to help control bl...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): C07K14/00A61K47/34A61K38/16A61P3/10
CPCA61K38/00A61K47/10C07K14/00
Inventor 罗瑞雪
Owner SUZHOU PULUODA BIOLOGICAL SCI & TECH