A structure prediction method for voltage-gated sodium ion channels
A technology of sodium ion channel and pore structure, which is applied in the field of structure prediction of voltage-gated sodium ion channel, can solve the problem of not fully considering the information of transmembrane region, and achieve the effect of reliable method, wide applicability and high reliability
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0022] Embodiment 1: The structure prediction method for voltage-gated sodium ion channel of the present invention
[0023] Include the following steps:
[0024] 1) Through the Na in NCBI v 1.5 Definition and division of each structural domain, determine Na v The amino acid sequence composition of 1.5_PD is as follows:
[0025] DI:
[0026] DVMVLTVFCLSVFALIGLQLFMGNLRHKCVRNFTALNGTNGSVEADGLVWESLDLYLSDPENYLLKNGTSDVLLCGNSSDAGTCPEGYRCLKAGENPDHGYTSFDSFAWAFLALFRLMTQDCWERLYQQTLRSAGKIYMIFFMLVIFLGSFYLVNLILAVVAMA
[0027] DII:
[0028] ALGNLTVLAIIVFIFAVVGMQLFGKNYSELRDSDSGLLPRWHMMDFFHAFLIIFRILCGEWIETMWDCMEVSGQSLCLLVFLLVMVIGNLVVLNLFLALLL
[0029] DIII:
[0030] AIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFGRCINQTEGDLPLNYTIVNNKSQCESLNLTGELYWTKVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRGYEEQPQWEYNLYMYIYFVIFIIFGSFFTLNLFIGVII
[0031] DIV:
[0032]ALFNIGLLLFLVMFIYSIFGMANFAYVKWEAGIDDMFNFQTFANSMLCLFQITTSAGWDGLLSPILNTGPPYCDPTLPNSNGSRGDCGSPAVGILFFTTYIIISFLIVVNMYIAIIL
[0033] (2) Using the HHpred method, the N...
Embodiment 2
[0050] Example 2 Na v 1.5 The interaction sites with open local anesthetic drugs are consistent with the experimental results
[0051] (1)Na v 1.5 Complexes with open local anesthetics (Na v 1.5_LA) can be constructed and selected for Na v 1.5 Four local anesthetic drug molecules (LA) acting in the open state: Flecainide, Pilsicainide, Cocaine, Ranolazine as inhibitor molecules. The molecular docking method used is: use REDUCE, Autodock Tools and Autodoc4 to complete. First pass the REDUCE procedure to Na v 1.5 Add hydrogen, and then use Autodock Tools script to Na respectively v 1.5 and LA molecules add Gaussian charges. Select the grid center to The space area within the scope of is the docking grid area, and AutoGrid is used to delineate the grid. Using LA and Na v 1.5 A fully flexible docking method for the binding site region, using Autodock4 for docking. during the docking process. Scoring adopts the method of combining Autodock4's own scoring and Xscore scor...
PUM
![No PUM](https://static-eureka.patsnap.com/ssr/23.2.0/_nuxt/noPUMSmall.5c5f49c7.png)
Abstract
Description
Claims
Application Information
![application no application](https://static-eureka.patsnap.com/ssr/23.2.0/_nuxt/application.06fe782c.png)
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap