Eureka AIR delivers breakthrough ideas for toughest innovation challenges, trusted by R&D personnel around the world.

Long-acting hypoglycemic and lipid-regulating polypeptide and application thereof

A blood sugar-lowering and fat-lowering technology, applied in the field of biochemical pharmacy, can solve problems such as lack of treatment methods, and achieve the effects of reducing glycated hemoglobin, lowering blood sugar, and inhibiting immune attack

Active Publication Date: 2019-01-04
CHINA PHARM UNIV
View PDF5 Cites 6 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

Patients with T1DM struggle to control blood sugar due to lack of new treatment modalities

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Long-acting hypoglycemic and lipid-regulating polypeptide and application thereof
  • Long-acting hypoglycemic and lipid-regulating polypeptide and application thereof
  • Long-acting hypoglycemic and lipid-regulating polypeptide and application thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0029] Embodiment 1 The duration of drug effect of polypeptide of the present invention and Progly peptide, VP peptide is compared

[0030] (1) Acute and sustained hypoglycemic effect of Progly peptide on normal mice

[0031] 8-week-old male C57BL / 6 mice were randomly divided into 5 groups, 10 in each group, respectively solvent control group (negative control group), PGLP-1 group (1nmol / kg), PGLP-1 group (30nmol / kg kg), PGLP-1 group (100nmol / kg), GLP-1 group (30nmol / kg) for glucose tolerance test. Wherein, PGLP-1 refers to Progly peptide, and GLP-1 refers to glucagon-like peptide-1.

[0032] The result is as figure 1 As shown in A, compared with the control group, both GLP-1 and PGLP-1 can significantly reduce the blood sugar level, and the area under the curve is significantly lower than that of the control group, indicating that PGLP-1 can be as sugar-dependent as GLP-1 Insulin-stimulating effect. At the same time, PGLP-1 (1, 30, 100nmol / kg) can lower blood sugar in a d...

Embodiment 2

[0041] Embodiment 2 Pharmacodynamic evaluation of the polypeptide of the present invention

[0042] (1) Modeling and grouping of STZ diabetic model mice

[0043] Eighty 6-week-old male c57 mice (purchased from the Experimental and Comparative Medicine Center of Yangzhou University, license number: SCXK (Su) 2012-0004) were adaptively fed for 1 week. Fasting for 12 hours before the experiment, intraperitoneal injection of STZ solution (citrate buffer solution with pH = 5.2) at a dose of 50 mg / kg for 5 consecutive days, fasting blood glucose was detected 1 week and 2 weeks after injection, and the blood glucose values ​​were all over 11.0mmol / L means successful modeling.

[0044] The model mice were randomly divided into 4 groups, 12 in each group, which were solvent control group (negative control group), PGLP-1 group (positive control group), VP group (positive control group), and P15 group (experimental group). The dosage is 30nmol / kg, twice a day, the solvent is normal sa...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention relates to a long-acting hypoglycemic and lipid-regulating polypeptide and application thereof. The amino acid sequence of the polypeptide is HGEGTFT SDVSSYLEGQAAKEFIAWLVKGRGPGVLGGGCRCIPALDSLTPANED. The application of the polypeptide is to prepare drugs or pharmaceutical compositions for the treating or preventing of type 1 diabetes and type 2 diabetes, and to prepare immunomodulatory drugs or pharmaceutical compositions. The long-acting hypoglycemic and lipid-regulating polypeptide can be used for achieving pharmacodynamic effect duration of up to 10 hours. The polypeptide is abifunctional polypeptide, the polypeptide can not only be the same as GLP-1 analogue, reduce the blood sugar and glycosylated hemoglobin of the type 1 diabetes patients, reduce the blood sugar, inhibit eating and reduce the glycosylated hemoglobin of the type 2 diabetes patients, but also can regulate immunity and inhibit pathological immune attacks as well as the VP peptid..

Description

technical field [0001] The invention relates to a long-acting hypoglycemic and lipid-lowering polypeptide, which has longer drug effect duration and immune regulation function, and belongs to the technical field of biochemical pharmacy. Background technique [0002] To the best of the knowledge of the inventors, type 1 diabetes (T1DM) is a disease characterized by absolute insulin deficiency due to destruction of pancreatic beta cells. At present, the research on type 1 diabetes is mainly divided into the early stage of diagnosis and prevention, and the middle and late stages of treatment. Among them, diagnosis and prevention mainly focus on the pathogenesis of diabetes and study the corresponding diagnostic methods and preventive measures. The pathogenesis of type 1 diabetes involves a T-cell-mediated autoimmune attack and, in susceptible individuals, B lymphocytes that produce antibody responses against β-cells, so patients have a long period of time before the onset of c...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): C07K19/00A61K38/26A61P3/10A61P37/02
Inventor 金亮高华山赵茜张艳峰卢世平
Owner CHINA PHARM UNIV
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com