40results about How to "Lower glycated hemoglobin" patented technology

The invention discloses a blood-glucose-lowering traditional Chinese medicine composition as well as a preparation method and application. Active components of the blood-glucose-lowering traditional Chinese medicine composition are prepared from a group A and a group B through gradient extraction of 70 percent to 30 percent alcohol-water solution or / and water, wherein the group A is prepared from the following components in parts by weight: 20 to 30 parts of folium mori, 10 to 20 parts of bitter gourds and 10 to 20 parts of radix puerariae; the group B comprises 5 to 15 parts of rhizoma dioscoreae by weight. Pharmaceutically acceptable auxiliary materials are added into the active components to prepare oral preparations including oral solutions, granules, tablets, hard capsules, soft capsules, pills and the like according to a conventional method. A pharmacodynamics test result shows that the blood-glucose-lowering traditional Chinese medicine composition can be used for remarkably lowering blood glucose, glycated hemoglobin (GHb) of experiment rats with type 2 diabetes mellitus and improving oxidative stress indexes, and also has a remarkable blood lipid regulation function and can be used for raising HDL-C (High Density Lipoprotein-Cholesterol) and lowering TC (Total Cholesterol), TG (Triglyceride) and LDL-C (Low-Density Lipoprotein Cholesterol). The active components of the traditional Chinese medicine composition are matched with rice and flour and can be processed into health foods capable of preventing and treating diabetes mellitus, such as porridge, noodles, bread and biscuits.

The invention provides a medicinal composition containing an atractylodes rhizome extractive, which can be composed of the atractylodes rhizome extractive, timosaponin B-II and berberine, can be also composed of the atractylodes rhizome extractive, a rhizoma anemarrhenae extractive and a phellodendron bark extractive, or can be obtained by directly extracting from atractylodes rhizome, rhizoma anemarrhenae and phellodendron bark. The composition of the invention has obvious effect of reducing blood sugar, high content of effective ingredients, easy quality control, easy industrialization of preparation process; and the composition can be applied to the medicine for preventing and treating diabetes.

The invention relates to a health staple food capable of reducing postprandial blood sugar, and also relates to a preparation method of the health staple food and its application in reducing blood sugar. The health staple food with a low glycemic index comprises, by weight, 51-61% of rice, 16-26% of peanut kernel, and 18-28% of peeled mung bean. With organic food as the raw material, the health staple food of the invention is totally prepared with a physical processing method, without any harmful components added. No natural nutritious component in the raw material can be damaged. As a pollution-free green food, the health staple food of the invention integrates nutrition, diseases prevention and disease curing, thus ushering in the application prospect of coarse cereal food. And the application value of coarse cereals is enhanced, with remarkable economic benefit and social benefit. With a low glycemic index, the integrated staple food provided in the invention plays a role in reducing postprandial blood sugar, reducing glycated hemoglobin, and has certain effect on fat-reducing, thus being significant to diabetic patients.

A process for preparing pumpkin polysaccharose includes such steps as preparing pumpkin powder, extracting in hot water, filering, depositing in alcohol, washing deposit, adding trichloroacetic acid, laying aside in refrigerator, centrifugal separating, dialysis and drying.

The invention relates to an siRNA for inhibiting expression of an FABP4 gene. A sequence of the siRNA is shown as follows: sense strand: 5'-CGACCACAAUAAAGAGAAA-3' antisense strand: 5'-UUUCUCUUUAUUGUGGUCG-3'. According to the siRNA disclosed by the invention, three pairs of siRNA sequences are designed, aiming at the FABP4 gene, and an siRNA which is capable of effectively down regulating expression of a target gene is screened by virtue of a cell transfection test; according to the screened siRNA-368 sequence, a corresponding lentivirus expression carrier is constructed; and verified by a test of transfecting an obese mouse with high fat and inhibiting expression of mouse visceral fat tissue FABP4 gene, the screened siRNA is capable of effectively inhibiting expression of the mouse FABP4 gene and lowering weight, glycosylated hemoglobin, total cholesterol and level of low-density lipoprotein cholesterol of the obese mouse with high fat.

The invention discloses a medicine for treating diabetes mellitus. The medicine is made by the following raw materials: balsam pear slices 30g, sophorae flavescentis radix 9g, coptis chinensis 30g, anemarrhenae rhizome 30g, spina date seed 15g, zingiberis rhizoma tostum 6g, monascus 3g, tangerine peel 9g, rhubarb 2g and persicae semen 6g. The invention achieves repeatable affirmation effect through the clinical test for treating 2-type diabetes mellitus by the heat clearing and cloud dropping method, which can improve a 2-type diabetes mellitus model rat abnormal glucose metabolism by means of the obvious improvement of insulin resistance and islet cell function. The invention has great significance on alleviating fatty liver and maintaining normal blood lipid.

The invention relates to the use of human bendazac lysine in pharmaceutical industry, wherein the bendazac lysine possesses substantial actions for reducing hypoglycemia and saccharifying hemoglobin and urine protein, thus can be applied to the prevention and treatment of diabetes.

The invention relates to a long-acting hypoglycemic and lipid-regulating polypeptide and application thereof. The amino acid sequence of the polypeptide is HGEGTFT SDVSSYLEGQAAKEFIAWLVKGRGPGVLGGGCRCIPALDSLTPANED. The application of the polypeptide is to prepare drugs or pharmaceutical compositions for the treating or preventing of type 1 diabetes and type 2 diabetes, and to prepare immunomodulatory drugs or pharmaceutical compositions. The long-acting hypoglycemic and lipid-regulating polypeptide can be used for achieving pharmacodynamic effect duration of up to 10 hours. The polypeptide is abifunctional polypeptide, the polypeptide can not only be the same as GLP-1 analogue, reduce the blood sugar and glycosylated hemoglobin of the type 1 diabetes patients, reduce the blood sugar, inhibit eating and reduce the glycosylated hemoglobin of the type 2 diabetes patients, but also can regulate immunity and inhibit pathological immune attacks as well as the VP peptid..

The invention discloses a method for preparing the effective component of a mottle clam health-care product with a hypoglycemic effect. The AGD (Alpha-Glucosaccharase) component contained in a mottle clam is obtained by adopting an enzymolysis technology on the mottle clam, and an AGD inhibitor can enable the postprandial blood sugar peak value of people to be gradually lowered and reduced in fluctuation so that glycosylated hemoglobin contained in blood plasma is reduced. The health-care product processed by utilizing the effective component has good activity inhibition effect on the alpha-glucosaccharase without side effect on a human body and can provide the amino acid needed by the human body, thereby becoming an auxiliary curing health-care product used for a diabetes patient. The method disclosed by the invention has the advantages of easily available raw materials and low price of raw materials, simple processing method, small investment, high additional value and very wide application prospect and can be widely used for producing the health-care product; and in addition, the method disclosed by the invention can stimulate the consumption domestic demand of the mottle clam, thereby accelerating the development of a mottle clam culture industry.

The invention discloses a medicine composition for treating type 2 diabetes. The medicine composition contains traditional Chinese medicine prepared according to the concrete patient conditions, and hypoglycemic Sanhuang tablets and berberine hydrochloride tablets which used together according to requirements, wherein the traditional Chinese medicine prepared according to the concrete patient conditions mainly includes five kinds of main medicine including radix puerariae, radix scutellariae, rhizomacoptidis, radix glycyrrhizaepreparata and prepared radix codonopsis, and ten kinds of other traditional Chinese medicine. Through clinical test, after traditional Chinese medicine compound treatment based on syndrome differentiation, the blood glucose of a patient is obviously lowered; the reduction degree of glycosylated hemoglobin is greater than 1.5 percent; the blood glucose reduction curative effect is obvious.

The invention relates to a medicinal liquor capable of reducing blood sugar and preventing and treating diabetic complications, which is prepared by a buckwheat wine and the Chinese medicinal herbs including frosted folium mori, folium ginkgo, cordyceps militaris, radix puerariae, fructus crataegi, flos carthami, dried sanguisuga and semen litchi etc. Compared with the prior art, the formula provided by the invention is scientific, the prescription is reasonable, and the medicinal liquor is capable of stably reducing the blood sugar, urine sugar and glycosylated hemoglobin, improving glucose tolerance indexes, simultaneously reducing blood fat, blood viscosity and blood pressure, improving the blood circulation, and alleviating insufficient blood supply to heart, brain and nerves; and meanwhile, the medicinal liquor is capable of effectively improving the symptoms, such as palpitation, cephalalgia, cardiopalmus, cutaneous pruritus, hypopsia, numbness of limb, cold hands and feet, insomnia and vexation and fatigue, and the product is free from toxic and side effects, so that the medicinal liquor is suitable for long-term drinking.

The invention discloses a traditional Chinese medicine for treating diabetes mellitus. The traditional Chinese medicine is prepared from the following raw materials in parts by weight: 50-100 parts of salvia miltiorrhiza, 50-100 parts of radix astragali, 30-60 parts of herba spirodelae, 10-40 parts of mulberry twig, 20-50 parts of semen coicis, 20-50 parts of kudzuvine root and 10-40 parts of hawthorn. Pharmacological experiments prove that the traditional Chinese medicine has the functions of obviously reducing fasting blood glucose and glycosylated haemoglobin of experimental rats with type 2 diabetes mellitus, reducing proteinuria of experimental rats with diabetic nephropathy and simultaneously regulating lipid metabolism of experimental rats with diabetic nephropathy. Clinical tests show that the traditional Chinese medicine has a total effective rate of 76.6% in treating patients with type 2 diabetes mellitus, does not have significant difference from metformin hydrochloride tablet control groups, but is superior to metformin hydrochloride tablets in improving clinical symptoms of type 2 diabetes mellitus and regulating lipid metabolism.

The invention discloses a traditional Chinese medicine composition for preventing and treating obese type 2 diabetes combined dyslipidemia, belongs to the technical field of traditional Chinese medicine. The traditional Chinese medicine composition is made, by weight ratio, from coptis chinensis, bitter gourds, rhizoma anemarrhenae, aloe, red yeast rice, schisandra chinensis, rhizoma zingiberis, salvia miltiorrhiza and other crude drugs, and gastrodia elata, uncaria, gynostemma pentaphylla, radix polygoni multiflori preparata, raw rhubarb, magnolia officinalis, radices trichosanthis, scutellaria baicalensis and other crude drugs can be further added into the traditional Chinese medicine composition when necessary. The traditional Chinese medicine composition has a significant therapeutic effect on obese type 2 diabetes combined dyslipidemia.

A new method for improvement of functions of diabetes islet beta cells is provided by combination of human umbilical cord mesenchymal stem cells and incretin, and the new method is as follows: on the basis of application of the human umbilical cord mesenchymal stem cells for treatment of type-1 and type-2 diabetes, the incretin (GLP-1 (glucagon-like peptide-1) receptor agonist and DPP-4 (dipeptidyl peptidase-4) inhibitor) is combined. The new method can promote islet beta cell proliferation and regeneration, improve the functions of the islet beta cells, reduce blood sugar and glycated hemoglobin, reduce islet alpha hyperplasia and inhibit glucagon secretion, and thus playing a synergy effect.

The invention relates to the technical field of additives for livestock and in particular relates to a composition for preventing and treating bovine rumen acidosis and a preparation method of the composition. The composition comprises the following raw materials in parts by weight: golden camellia, folium isatidis, dandelion, purslane, poria cocos, fructus amomi, white paeony root, radix ophiopogonis, ephedra, puerarin, cinnamon, patrinia, rhizoma phragmitis, rehmannia, aloe, semen cuscutae, moutan bark, albumen powder and saccharomyces cerevisiae. The composition disclosed by the invention has an obvious effect of preventing and treating bovine rumen acidosis and can effectively reduce the incidence rate of the bovine rumen acidosis to 2.3-2.6%; due to a reasonable ratio, the Chinese herbal medicines can achieve excellent synergistic effects, the rumen pH value is effectively regulated, a balance of the rumen biota system is maintained, the bovine rumen acidosis is prevented to the greatest degree, and the composition achieves extremely important significances for improving the cattle production performance, reducing economic losses and promoting sustainable and healthy development of the cattle breeding industry.

The invention provides biological organic selenium vinegar and a production method thereof. The biological organic selenium vinegar adopts a solid state fermentation biological engineering technology, and the production method comprises the steps: taking ginkgo and tartary buckwheat as major raw materials, mixing with sodium selenite, Daqu, and saccharomyces cerevisiaethe with the preservation number of CGMCC No.9507, carrying out saccharification, alcoholic fermentation, biological organic selenium synthesis and acetic acid fermentation, then carrying out smoking solid-substrate fermentation, carrying out vinegar pouring, and aging to obtain the biological organic selenium vinegar. Besides having general vinegar characteristics, the produced biological organic selenium vinegar is also rich in selenoproteins, selenium amino acids, selenium polysaccharides and other biological organic selenium synthesized by microorganisms, and is pure in taste; and the contained biological organic selenium has high safety, and is more easily absorbed, converted and utilized by human bodies.

The invention relates to dual-function polypeptide having effects of reducing blood sugar and regulating immunity and the use of the dual-function polypeptide, and belongs to the technical field of biochemical pharmacy. The dual-function polypeptide is combined polypeptide of blood sugar reducing polypeptide and immunity regulating polypeptide, and flexible connecting peptide is arranged or is notarranged between the blood sugar reducing peptide and the immunity regulating peptide. The dual-function polypeptide having effects of reducing blood sugar and regulating immunity has the function ofa GLP-1 analog, promotes proliferation of pancreatic beta cells, reduces the blood sugar of a patient suffering from type I diabetes and reduces saccharification hemochrome, reduces blood sugar of apatient suffering from type II diabetes, restrains feeding and reduces saccharification hemochrome, also has the functions of immunity regulating peptide of autologous antigen of the type I diabetes,regulates immunity, and restrains pathological immunity attack.

The invention relates to a formula of mulberry leaf extract tablets. The formula comprises the following components in parts by weight: 40-50 parts of a mulberry leaf extract, 10-15 parts of a fagopyrum tararicum extract, 10-20 parts of a kudzu-vine root extract, 15-20 parts of an astragalus root extract, 6-10 parts of starch, 2-4 parts of xylitol, 2-4 parts of hydroxypropyl methyl cellulose and 1-2 parts of magnesium stearate. The formula overcomes defects of the prior art, on the basis of blood sugar reduction functions of the mulberry leaf extract and the fagopyrum tararicum extract, functions of generating body fluid and quenching thirst and reducing blood sugar, of the kudzu-vine root extract, and functions of enriching qi and reducing blood sugar, of the astragalus root extract, scientific and reasonable compatibility is achieved, and the mulberry leaf extract tablets have good blood sugar reduction functions.

The invention discloses a traditional Chinese medicine prescription for treating an overweight / obesity type polycystic ovary syndrome. A basic prescription is prepared from the following traditional Chinese medicine raw materials in parts by weight: 10 to 30 parts of radix codonopsis, 5 to 15 parts of bighead atractylodes rhizome, 5 to 15 parts of poria cocos, 3 to 9 parts of cassia twig, 3 to 9 parts of radix et rhizoma rhei, 5 to 15 parts of herba artemisiae capillariae, 5 to 15 parts of rhizoma alismatis, 5 to 15 parts of rhizoma sparganii, 5 to 15 parts of rhizoma curcumae, 5 to 15 parts of herba epimedii and 3 to 6 parts of prepared liquorice root. The traditional Chinese medicine prescription disclosed by the invention has refined compatibility and basic traditional Chinese medicineraw materials are adopted; metabolism and reproductive-endocrine disorder are considered, the difficult of researching and developing overweight / obesity type polycystic ovary syndrome medicines at present is smoothly solved and a satisfied curative effect is obtained. The prescription is a traditional Chinese medicine compound prescription considering the metabolism and the reproductive-endocrinedisorder; the prescription is simple and the effect is clear; the prescription has a wide popularization prospect in clinical application, and is prepared into various Chinese patent drugs with different preparations so that the prescription is more convenient for patients; the total cost is low so that the financial burden of the patients can be alleviated to the great extent and the medical burden of China is alleviated to a certain extent.

The present invention provides applications of a traditional Chinese medicine composition in preparation of blood glucose lowering drugs, wherein the traditional Chinese medicine composition comprises, by mass, 1-3 parts of Acanthopanax senticosus, 0.5-1.5 parts of Angelica sinensis, and 1-3 parts of Milkvetch Root. The present invention further provides applications of a composition in preparation of blood glucose lowering drugs, wherein the composition comprises, by mass, 1-3 parts of an Acanthopanax senticosus extract, 0.5-1.5 parts of an Angelica sinensis extract, and 1-3 parts of a Milkvetch Root extract. According to the present invention, Acanthopanax senticosus, Angelica sinensis and Milkvetch Root are used as the active components and are used for preparing blood glucose loweringdrugs; and the experimental results show that the traditional Chinese medicine composition can significantly reduce the fasting blood glucose of mice, reduce the glycated hemoglobin of diabetic mice,and increase the serum insulin secretion, and has obvious effect superior to the traditional Chinese medicine composition containing complex components, wherein the effect difference between the traditional Chinese medicine composition of the present invention and the traditional Chinese medicine composition containing complex components is significant (P < 0.05).

The present invention discloses a traditional Chinese medicine preparation for treating diabetic nephropathy, which is prepared from rhubarb polysaccharides, the total flavone of scutellaria root, total alkaloids of rhizoma coptis, and pharmaceutically acceptable auxiliary materials. Pharmacodynamic trials proved that the present invention has the effects of decreasing the blood glucose of the normal mouse, reducing the area under blood glucose concentration curve, and improving the sugar tolerance of the mouse; the present invention can improve the multi-food, the will drink, and the polyuriasymptoms of diabetic nephropathy model rats, reduce urinary protein and urinary albumin, decrease glycosylated hemoglobin, serum cholesterol and serum triglyceride, decrease overhigh creatinine clearance rate, reducing the renal index, alleviate the renal lesion, and have the effect for antagonizing early diabetic nephropathy. In addition, the present invention also discloses a preparation methodof the traditional Chinese medicine preparation and application in preparing a medicament for preventing and controlling diabetic nephropathy.

The invention provides a composition for preventing and / or treating obesity and hyperglycaemia. The composition comprises rhizoma polygonati, the root of kudzu vine and cinnamomum cassia. The composition is prepared from medicinal materials with the homology of medicine and food, which is safe. It is accidentally found that the composition has extremely good synergistic effect, and the BMI index,triglyceride, fasting blood sugar and glycosylated hemoglobin of people who are fat and have hyperglycaemia can be effectively reduced.

The invention relates to an application of stomach-regulating qi-supporting decoction in preparation of a medicine for preventing and treating metabolic syndrome caused by olanzapine taken by schizophrenia patients. Clinical experiments prove that the curative effect and safety of the stomach-regulating qi-supporting decoction for treating metabolic syndrome caused by taking olanzapine by schizophrenia patients are evaluated; results show that compared with metformin, the stomach-regulating qi-supporting decoction can better improve weight and waistline increase caused by taking olanzapine byschizophrenia patients, reduce glycosylated hemoglobin and reduce side effects; the stomach-regulating qi-supporting decoction has a prevention effect on disorder of various indexes of blood fat caused by taking olanzapine. The invention provides a new effective means for preventing and treating metabolic syndrome caused by taking olanzapine by clinical schizophrenia patients.

The invention provides a polypeptide with excellent activities, after combination with amino acids, the stability is improved, and the hypoglycemic and lipid-lowering activities are improved. The polypeptide and a composition thereof with the amino acids are resistant to pepsin and trypsin hydrolysis, so that the polypeptide and the composition can be administered orally and injected intravenously, intramuscularly or subcutaneously. The polypeptide and the composition are rare hypoglycemic and hypolipidemic medicines that can be used by four administration modes. The polypeptide and the composition are flexible in medication modes, have the function of protecting and repairing pancreatic beta cells, do not cause hypoglycemia reaction and insulin resistance in patients, have no toxic and side effects, are convenient and safe to use, can be stored stably for a long time, and can effectively prevent and treat type 2 diabetes diabetes and hyperlipidemia. Compared with the existing hypoglycemic drugs, the polypeptide and the composition can effectively reduce glycated hemoglobin of the diabetic patients, and has obvious advantages of additional cardiovascular benefits and reduction of diabetic complications.

The invention provides a composite consisting of pollen and bitter buckwheat as well as preparation including the composite. The preparation can be tablets, capsules, grains, powder, pills, and the like. The bitter buckwheat in the composite prescription accounts for 1-99%wt of the total weight of the composite and the pollen accounts for 1-99%wt of the total weight of the composite. The preparation is manufactured by adopting the normal techniques of tablets, capsules, grains, powder and pills on the materials and accessories. The preparation has the blood-sugar reducing function.

The invention discloses a method for preparing traditional Chinese medicine composition for treating diabetic nephropathy and belongs to the technical field of traditional Chinese medicines. The traditional Chinese medicine composition is prepared from raw materials as follows: total flavones of moringa oleifera leaves, stibene glucoside, ginsenoside Rb1, ginsenoside Rg1, ginsenoside Rd, ginsenoside Re, ginkgolide, kaempferol and quercetin. The prepared traditional Chinese medicine composition has high synergistic effect, used as drugs for treating the diabetic nephropathy through combination, and clinical trials verify that quite remarkable effect is obtained.

The invention discloses a pharmaceutical composition for treating diabetic nephropathy and application of the pharmaceutical composition. The composition is prepared from a traditional Chinese medicine extract and auxiliary materials, wherein the traditional Chinese medicine extract is an alcohol extract which is extracted from brassaiopsis tripteris as a raw material by using an ethanol solution of which the volume concentration is 92%-98%. According to the pharmaceutical composition disclosed by the invention, blood glucose and glycosylated hemoglobin of a patient with diabetic nephropathy can be lowered; the urine volume is controlled; the urinary albumin excretion is reduced; and the pharmaceutical composition plays repairing and improving roles in functions of glomerulus and kidney tubules, so that the kidney function of the patient is improved.

The invention provides oral paste with a blood glucose reducing function. The oral paste is prepared from, by weight, 45-50 parts of carboxymethyl pachymaran, 20-30 parts of cyclocarya paliurus leaves, 12-17 parts of inulin, 3-8 parts of earthworm protein, 20-30 parts of camellia chrysantha, 20-30 parts of fructus lycii, 20-30 parts of cinnamon, 20-30 parts of Chinese yam, 30-40 parts of rhizoma polygonati, 20-30 parts of radix puerariae, 10-15 parts of stigma maydis and 0.5-1 part of stevioside. The raw materials are wide in source, a preparation method is simple, the prepared oral paste hasthe effects of obviously reducing blood glucose, urine glucose, blood lipid and glycosylated hemoglobin, improving the insulin function, controlling blood lipid, enhancing immunity and the like, and has wide application prospects.

The invention discloses blood glucose reducing capsules. The capsules are prepared from a traditional Chinese medicine extract and adjuvant materials, wherein the traditional Chinese medicine extractis prepared from the following medicines by a mass ratio: 15g of rhizoma atractylodis, 15g of foldleaf daylily root, 15g of radix trichosanthis, 10g of pericarpium citri reticulatae, 15g of rhizoma dioscoreae, 15g of radix rehmanniae, 15g of fructus lycii, 10g of rhizoma panacis japonici, 10g of radix scrophulariae, 10g of semen cuscutae and 10g of rhizoma pinelliae preparata; the adjuvant materials are one or more of starch, calcium sulfate, calcium hydrogen phosphate, microcrystalline cellulose, sodium carboxymethyl starch, lactose, sodium carboxymethyl starch, hydroxypropyl cellulose, low-substituted propyl cellulose, crosslinked polyvinylpyrrolidone and croscarmellose sodium. A preparation method comprises the steps of preparing decoction liquid, and extracting effective components ofthe traditional Chinese medicines to obtain an intermediate; preparing the obtained intermediate into hard capsules on a machine, or adding the adjuvant materials to prepare hard capsules. The blood glucose reducing capsules provided by the invention are light in weight, convenient to carry and take by a patient, safe and stable to use, obvious in curative effect, and good for the heath of the patient. The blood glucose reducing capsules are suitable for auxiliary blood glucose reduction of type 2 diabetes mellitus.